DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30280 and Angptl1

DIOPT Version :9

Sequence 1:NP_611641.6 Gene:CG30280 / 37522 FlyBaseID:FBgn0050280 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_001102853.1 Gene:Angptl1 / 679942 RGDID:1598128 Length:300 Species:Rattus norvegicus


Alignment Length:123 Identity:22/123 - (17%)
Similarity:37/123 - (30%) Gaps:45/123 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 FGNLEAIYEQAENALSTLQESLLQLETNGTLNTSPDVI--------------------------- 65
            :.:|..:.......::.|:|..|:|.:....:.||.::                           
  Rat   178 YASLTDLVNNQSVMITVLEEQCLRLFSRQDPHVSPPLVQVVPRHIPNSHQDTPGLLAGNEIQRDP 242

  Fly    66 -YPTSCLTSGDLENGLHTLKVPGLSPFQVYCENQLAGPGWIVIQKRFSGNLSFFRNWK 122
             ||...:...||..      .|..|||::        |....|.:   |.|.|...||
  Rat   243 GYPRDLMPPPDLAT------APTKSPFKI--------PAVTFINE---GELPFPGQWK 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30280NP_611641.6 FReD 65..279 CDD:238040 15/86 (17%)
Angptl1NP_001102853.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 186 1.000 Domainoid score I3251
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm12326
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X25
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.