DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30280 and LOC594984

DIOPT Version :9

Sequence 1:NP_611641.6 Gene:CG30280 / 37522 FlyBaseID:FBgn0050280 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_001025596.1 Gene:LOC594984 / 594984 -ID:- Length:318 Species:Xenopus tropicalis


Alignment Length:209 Identity:88/209 - (42%)
Similarity:120/209 - (57%) Gaps:4/209 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 LTSGDLENGLHTLKVPGLSPFQVYCENQLAGPGWIVIQKRFSGNLSFFRNWKEYKNGFGNLMDEY 135
            |..|...:|.:|:..|...|..|:|:.:..|.||||.|:|..|::.||:.|..||.|||....|:
 Frog   113 LDQGASISGWYTIYRPNGLPLPVFCDMETDGGGWIVFQRRKDGSVDFFQEWDSYKRGFGRQDSEF 177

  Fly   136 FLGLEKIRALTALEPHELYVHLEDFDDTIKHAKFDEFAIGNEDDDYAMNTLGKYSGTAGDSLRSH 200
            :||.|.:..|||....:|.|.|.|||.....|.:..|.||.|..:|.::..|...|.|||||..|
 Frog   178 WLGNENLHLLTATGNFQLRVDLMDFDSNRTFASYSNFRIGGESRNYTLSLGGFTGGDAGDSLSGH 242

  Fly   201 RKMKFSTYDRDNDHEFNKNCAFYYLGGWWYNACLDSNLNGQYMPGGKYEESLFARGMCWRSWRGH 265
            :..:||:.|||||.. ..:||..|.|.|||:.|..|||||.|: |||:  ..||.|:.|:|..|:
 Frog   243 KNREFSSKDRDNDSS-PTSCAERYKGAWWYSGCHTSNLNGLYL-GGKH--GSFANGVNWKSGGGY 303

  Fly   266 NYGYRVTQMMIRPK 279
            ||.|:|::|..||:
 Frog   304 NYSYKVSEMKFRPQ 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30280NP_611641.6 FReD 65..279 CDD:238040 87/207 (42%)
LOC594984NP_001025596.1 Collagen 42..99 CDD:189968
FReD 107..316 CDD:238040 86/206 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 182 1.000 Domainoid score I3392
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 171 1.000 Inparanoid score I3986
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 1 1.000 - - mtm14088
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.050

Return to query results.
Submit another query.