DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30280 and fgl2a

DIOPT Version :9

Sequence 1:NP_611641.6 Gene:CG30280 / 37522 FlyBaseID:FBgn0050280 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_001020710.1 Gene:fgl2a / 565637 ZFINID:ZDB-GENE-030131-9506 Length:451 Species:Danio rerio


Alignment Length:292 Identity:105/292 - (35%)
Similarity:148/292 - (50%) Gaps:50/292 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 ETLNLFG--NLEAIYE-QAENALSTL------------QESLLQLETNGTLNTSPDVIYPTSCLT 72
            |.|||..  |:|.|.: :.||....:            |:..||..||         |.|..|..
Zfish   171 EELNLLNLQNVENIVDRKVENITGMVNKISSTCTSCPGQQLQLQHLTN---------IPPRDCSD 226

  Fly    73 SGDLENGLHTLKVPGLSP------FQVYCENQLAGPGWIVIQKRFSGNLSFFRNWKEYKNGFGNL 131
            ...|  |....||..::|      |.|||:.:..|.||.|||.|.:|::||.|.|.:||.|||||
Zfish   227 ISML--GQRINKVYQVTPDPRNGSFAVYCDMESFGGGWTVIQHRINGSVSFNRTWADYKKGFGNL 289

  Fly   132 MDEYFLGLEKIRALTALEPHELYVHLEDFDDTIKHAKFDEFAIGNEDDDYAMNTLGKYSGTAGDS 196
            ..|::||.:||..||..:...|.:.|||.:.|..:||:|:|.:.||...|.::..| ||||||::
Zfish   290 NSEFWLGNDKIHLLTKAKDMILRIELEDSEGTRGYAKYDQFYVSNEFLHYRLSVSG-YSGTAGNA 353

  Fly   197 LR-----SHRKMKFSTYDRDNDHEFNKNCAFYYLGGWWYNACLDSNLNGQYMPGGKYEESLFARG 256
            |:     :|.:..|:|.|:|||...:.||..||..|||::||:.:||||:|.. .||:..  ..|
Zfish   354 LQFSKHFNHDQKFFTTPDKDNDRYPSGNCGAYYGSGWWFDACMSANLNGKYYK-TKYKGK--RDG 415

  Fly   257 MCWRSW---------RGHNYGYRVTQMMIRPK 279
            :.|.:|         ......|:..:||||||
Zfish   416 IFWGTWPNATSEYYPTSFRQAYKNVKMMIRPK 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30280NP_611641.6 FReD 65..279 CDD:238040 89/233 (38%)
fgl2aNP_001020710.1 FReD 219..447 CDD:238040 89/233 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.