DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30280 and angptl6

DIOPT Version :9

Sequence 1:NP_611641.6 Gene:CG30280 / 37522 FlyBaseID:FBgn0050280 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_001014821.1 Gene:angptl6 / 561927 ZFINID:ZDB-GENE-030131-9735 Length:489 Species:Danio rerio


Alignment Length:278 Identity:100/278 - (35%)
Similarity:153/278 - (55%) Gaps:22/278 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 SVMIFCHAETLNLFGNLEAIYEQAENALSTLQESLLQL--ETNGTLNTSPDVIYPTS-------- 69
            ||::..:.|..::..:..|.:.||:     .::.||:.  ::.|....:|.:.:|::        
Zfish   219 SVLVNINTEPKDVQRDQSAPFHQAQ-----ARQELLETFDDSPGPPTETPFISFPSTKSPGPWHD 278

  Fly    70 C---LTSGDLENGLHTLKVPGLSP-FQVYCENQLAGPGWIVIQKRFSGNLSFFRNWKEYKNGFGN 130
            |   |.||:..:|::.|:....:. .|.:|:...|..||.|||:|..|:::|||.|.:||.||||
Zfish   279 CHNVLESGEKTSGIYLLRPRNTNRLLQAWCDQSRAQGGWTVIQRRQDGSVNFFRTWDQYKQGFGN 343

  Fly   131 LMDEYFLGLEKIRALTALEPHELYVHLEDFDDTIKHAKFDEFAIGNEDDDYAMNTLGKYSGTAGD 195
            |..||:||||.:..||:...::|.|.:||:.....:|::|.|.:..|.|.|.:. ||.|.|||||
Zfish   344 LDGEYWLGLEHLYWLTSQATYKLRVAMEDWQGRQVYAEYDSFRVEPESDWYRLR-LGSYQGTAGD 407

  Fly   196 SLRSHRKMKFSTYDRDNDHEFNKNCAFYYLGGWWYNACLDSNLNGQYMPGGKYEESLFARGMCWR 260
            ||..|....|:|.|||.| .:..|||.|..|||||:.|..|||||.:..||.| .|.:..|:.|.
Zfish   408 SLSWHNNKAFTTLDRDKD-AYTGNCAHYQKGGWWYHMCAHSNLNGVWYRGGHY-RSRYQDGVYWA 470

  Fly   261 SWRGHNYGYRVTQMMIRP 278
            .:.|.:|..:...|||:|
Zfish   471 EFHGGSYSLKKVAMMIKP 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30280NP_611641.6 FReD 65..279 CDD:238040 90/226 (40%)
angptl6NP_001014821.1 DUF1640 <46..150 CDD:285090
DUF4349 <126..230 CDD:305044 3/10 (30%)
FReD 274..488 CDD:238040 88/216 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 171 1.000 Inparanoid score I4088
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 1 1.000 - - mtm6515
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3359
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.