DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30280 and Angptl3

DIOPT Version :9

Sequence 1:NP_611641.6 Gene:CG30280 / 37522 FlyBaseID:FBgn0050280 Length:288 Species:Drosophila melanogaster
Sequence 2:XP_006238502.1 Gene:Angptl3 / 502970 RGDID:1564505 Length:455 Species:Rattus norvegicus


Alignment Length:297 Identity:79/297 - (26%)
Similarity:140/297 - (47%) Gaps:54/297 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 NLEAIYEQAENALSTLQESL------------------LQLETNGTLNTSPDVIY---------- 66
            :|::..||.:|::..|.:|:                  .||...|....:.:.:|          
  Rat   163 SLKSFVEQQDNSIRELLQSVEEQYKQLSQQHIQIKEIENQLRKTGIQEPTENSLYSKPRAPRTTP 227

  Fly    67 ---------------PTSC---LTSGDLENGLHTLKVPGLSPFQVYCENQLAGPGWIVIQKRFSG 113
                           |..|   ...|:..:|::|::......|.|||:.| :|....:||.|..|
  Rat   228 PLHLKEAKNIEQDDLPADCSAIYNRGEHTSGVYTIRPSSSQVFNVYCDTQ-SGTPRTLIQHRKDG 291

  Fly   114 NLSFFRNWKEYKNGFGNLMDEYFLGLEKIRALTALEPHELYVHLEDFDDTIKHAKFDEFAIGNED 178
            :.:|.:.|:.|:.|||.|..|::||||||.|:.....:.|.:.|:|:.|:..:|:: .|.:||.:
  Rat   292 SQNFNQTWENYEKGFGRLDGEFWLGLEKIYAIVKQSNYILRLELQDWKDSKHYAEY-SFHLGNHE 355

  Fly   179 DDYAMNTLGKYSGTAGDSLRSHRKMKFSTYDRDNDHEFNKNCAFYYLGGWWY-NACLDSNLNGQY 242
            .:|.:: :.:.:....::|..||.:.|||:|.....:.  .|...|.||||: :.|.::||||:|
  Rat   356 TNYTLH-VAEIAANIPEALPEHRDLMFSTWDHRAKGQL--YCPESYSGGWWFSDMCGENNLNGKY 417

  Fly   243 -MPGGKYEESLFARGMCWRSWRGHNYGYRVTQMMIRP 278
             .|..|.:... .||:.||...|..|..:.::||::|
  Rat   418 NKPRAKSKPER-RRGISWRPRGGKLYSIKSSKMMLQP 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30280NP_611641.6 FReD 65..279 CDD:238040 70/244 (29%)
Angptl3XP_006238502.1 SPEC <34..193 CDD:295325 6/29 (21%)
FReD 241..453 CDD:238040 68/217 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.