DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30280 and MFAP4

DIOPT Version :9

Sequence 1:NP_611641.6 Gene:CG30280 / 37522 FlyBaseID:FBgn0050280 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_001185624.1 Gene:MFAP4 / 4239 HGNCID:7035 Length:279 Species:Homo sapiens


Alignment Length:266 Identity:97/266 - (36%)
Similarity:138/266 - (51%) Gaps:31/266 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 QAENALSTLQESLLQLETNGTLNTSP----------DVI------YPTSC---LTSGDLENGLHT 82
            :|:..|  |:.:||.|.....|:|.|          |.:      .|..|   ...|...:|::.
Human    18 KAQGVL--LKLALLALPLLLLLSTPPCAPQVSGIRGDALERFCLQQPLDCDDIYAQGYQSDGVYL 80

  Fly    83 LKVPGLS-PFQVYCENQLAGPGWIVIQKRFSGNLSFFRNWKEYKNGFGNLMDEYFLGLEKIRALT 146
            :...|.| |..|:|:....|..|.|.||||:|::||||.|.:||.|||....||:|||:.:..||
Human    81 IYPSGPSVPVPVFCDMTTEGGKWTVFQKRFNGSVSFFRGWNDYKLGFGRADGEYWLGLQNMHLLT 145

  Fly   147 ALEPHELYVHLEDFDDTIKHAKFDEF-----AIGNEDDDYAMNTLGKYSGTAGDSLRSHRKMKFS 206
            ..:.:||.|.||||::...:||:.:|     |:..|:|.|.:...|...|.|||||..|...|||
Human   146 LKQKYELRVDLEDFENNTAYAKYADFSISPNAVSAEEDGYTLFVAGFEDGGAGDSLSYHSGQKFS 210

  Fly   207 TYDRDNDHEFNKNCAFYYLGGWWYNACLDSNLNGQYMPGGKYEESLFARGMCWRSWRGHNYGYRV 271
            |:|||.| .|.:|||....|.:|:.:|..:||||.|:.|....   :|.|:.|..|:|..|..:.
Human   211 TFDRDQD-LFVQNCAALSSGAFWFRSCHFANLNGFYLGGSHLS---YANGINWAQWKGFYYSLKR 271

  Fly   272 TQMMIR 277
            |:|.||
Human   272 TEMKIR 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30280NP_611641.6 FReD 65..279 CDD:238040 87/228 (38%)
MFAP4NP_001185624.1 FReD 60..278 CDD:238040 87/222 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 186 1.000 Domainoid score I3350
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 188 1.000 Inparanoid score I3915
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 1 1.000 - - otm40314
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
66.060

Return to query results.
Submit another query.