DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30280 and fga

DIOPT Version :9

Sequence 1:NP_611641.6 Gene:CG30280 / 37522 FlyBaseID:FBgn0050280 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_001181918.1 Gene:fga / 378986 ZFINID:ZDB-GENE-031010-21 Length:684 Species:Danio rerio


Alignment Length:222 Identity:78/222 - (35%)
Similarity:122/222 - (54%) Gaps:24/222 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 ENGLHTLKVPGLSP-FQVYCENQLAGPGWIVIQKRFSGNLSFFRNWKEYKNGFGNL----MDEYF 136
            ::|:..:|..|... .:|||:......||.::|:|..|:::|.|.||||.||||.:    ..|.:
Zfish   466 QSGMFKIKPAGSEEVVEVYCDQSTGLGGWTLVQQREDGSVNFNRTWKEYLNGFGQIDKQGKGEIW 530

  Fly   137 LGLEKIRALTALEPHELYVHLEDFDDTIKHAKFDEFAIGNEDDDYAMNTLGKYSGTAGDSL---- 197
            :|.:.:..||..| ..|.|.|:|:.....:|::: ..:|:|.:.:.: |...|.|.|||:|    
Zfish   531 IGNKFLHLLTQKE-SLLRVELQDWTGAEAYAEYN-IKVGSEAEGFPL-TASDYDGDAGDALVRGH 592

  Fly   198 ------RSHRKMKFSTYDRDNDHEFNKNCAFYYLGGWWYNACLDSNLNGQYMPGGKYEESL---- 252
                  .||..|||||:|||:| ::.:|||..|.||||||.|..:||||.|..||:|:.:.    
Zfish   593 PNLGSFLSHAGMKFSTFDRDSD-KWEENCAEMYGGGWWYNNCQSANLNGIYYKGGQYDPATKVPY 656

  Fly   253 -FARGMCWRSWRGHNYGYRVTQMMIRP 278
             ...|:.|..::..:|..:|.:|.|||
Zfish   657 EIENGVVWLPFKPADYSLKVVRMKIRP 683

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30280NP_611641.6 FReD 65..279 CDD:238040 78/222 (35%)
fgaNP_001181918.1 Fib_alpha 46..185 CDD:285864
FReD 453..684 CDD:238040 78/222 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.