DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30280 and Fga

DIOPT Version :9

Sequence 1:NP_611641.6 Gene:CG30280 / 37522 FlyBaseID:FBgn0050280 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_001008724.1 Gene:Fga / 361969 RGDID:2603 Length:782 Species:Rattus norvegicus


Alignment Length:301 Identity:107/301 - (35%)
Similarity:160/301 - (53%) Gaps:47/301 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VPVFSVCIALSVMIFCHAETLNLFGNLEAIYEQAENALSTL-QESLLQLETNG---TLNTSPDVI 65
            ||.||          ..::|..:...:...|:.|:.|.|.. ||...:....|   |:....||:
  Rat   498 VPEFS----------SSSKTSTVRKQVTKSYKMADEAASEAHQEGDTRTTKRGRARTMRDCDDVL 552

  Fly    66 --YPTSCLTSGDLENGLHTLKVPGLSP-FQVYCENQLAGPGWIVIQKRFSGNLSFFRNWKEYKNG 127
              :|:..      :||:.::|:||.|. |.|||:.:.:..||::||:|..|:|:|.|.|::||.|
  Rat   553 QTHPSGA------QNGIFSIKLPGSSKIFSVYCDQETSLGGWLLIQQRMDGSLNFNRTWQDYKRG 611

  Fly   128 FGNLMD----EYFLGLEKIRALTALEPHELYVHLEDFDDTIKHAKFDEFAIGNEDDDYAMNTLGK 188
            ||:|.|    |::||.:.:..|| |....|.|.|||:.....:|:: .|.:|:|.:.||:. :..
  Rat   612 FGSLNDKGEGEFWLGNDYLHLLT-LRGSVLRVELEDWAGKEAYAEY-HFRVGSEAEGYALQ-VSS 673

  Fly   189 YSGTAGDSL-----------RSHRKMKFSTYDRDNDHEFNKNCAFYYLGGWWYNACLDSNLNGQY 242
            |.|||||:|           .||..|:|||:|||.| ::.:|||..|.||||||:|..:||||.|
  Rat   674 YQGTAGDALMEGSVEEGTEYTSHSNMQFSTFDRDAD-QWEENCAEVYGGGWWYNSCQAANLNGIY 737

  Fly   243 MPGGKYEES-----LFARGMCWRSWRGHNYGYRVTQMMIRP 278
            .|||.|:..     ....|:.|..:||.:|..|..:|.|||
  Rat   738 YPGGTYDPRNNSPYEIENGVVWVPFRGADYSLRAVRMKIRP 778

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30280NP_611641.6 FReD 65..279 CDD:238040 92/237 (39%)
FgaNP_001008724.1 Fib_alpha 51..189 CDD:285864
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 264..374
Fibrinogen_aC 388..453 CDD:288972
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 522..542 5/19 (26%)
FReD 546..779 CDD:238040 94/243 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.