DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30280 and CG9500

DIOPT Version :9

Sequence 1:NP_611641.6 Gene:CG30280 / 37522 FlyBaseID:FBgn0050280 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_609018.3 Gene:CG9500 / 33888 FlyBaseID:FBgn0031804 Length:292 Species:Drosophila melanogaster


Alignment Length:262 Identity:117/262 - (44%)
Similarity:171/262 - (65%) Gaps:14/262 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 ETLNLFGNLEAIYEQAENALST--LQESLLQLETNGTLNTSPDVIYPTSCLTSGDLENGLHTLKV 85
            |..:|:..:.|:.|:.::..||  :|:|...|.|.|....     ||:.|.|... .:|::|::|
  Fly    37 ELKSLYKLVLALLEENQSNASTENIQKSSSDLNTTGLSGR-----YPSQCPTYPP-AHGIYTVQV 95

  Fly    86 PGLSPFQVYCENQLAGPGWIVIQKRFSGNLSFFRNWKEYKNGFGNLMDEYFLGLEKIRALTALEP 150
            .||.||||.|:.::||.||.|:.:|.|..|:|||:|.|||||||.|..::|:||:|:.|:|..:|
  Fly    96 LGLKPFQVSCDAEIAGTGWTVMARRTSNKLNFFRSWAEYKNGFGQLDGDFFIGLDKLHAITKSQP 160

  Fly   151 HELYVHLEDFDDTIKHAKFDEFAIGNEDDDYAMNTLGKYSGTAGDSLRSHRKMKFSTYDRDNDHE 215
            ||||:|||||:...::|.:||..|.:|:..|||..||:::|.||||:..:|...|||:||||| .
  Fly   161 HELYIHLEDFEGQTRYAHYDEIFIESENKFYAMTKLGEFTGDAGDSMIHNRNQNFSTFDRDND-G 224

  Fly   216 FNKNCAFYYLGGWWYNACLDSNLNGQYMPG--GKYEESLFARGMCWRSWRGHNYGYRVTQMMIRP 278
            ::||||..|:|.||:..|..|||.|.|:.|  |:|.:   .:|:.|.|||..:|.|:|.|||:||
  Fly   225 WHKNCAEEYVGAWWHLNCTYSNLFGIYVKGDEGQYFQ---WKGIVWHSWRTESYSYKVMQMMVRP 286

  Fly   279 KC 280
            ||
  Fly   287 KC 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30280NP_611641.6 FReD 65..279 CDD:238040 103/215 (48%)
CG9500NP_609018.3 FReD 76..287 CDD:238040 103/220 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467659
Domainoid 1 1.000 190 1.000 Domainoid score I3199
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H122246
Inparanoid 1 1.050 171 1.000 Inparanoid score I4088
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D49112at7147
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 1 1.000 - - mtm6504
orthoMCL 1 0.900 - - OOG6_100073
Panther 1 1.100 - - P PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
1110.900

Return to query results.
Submit another query.