DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30280 and CG6788

DIOPT Version :9

Sequence 1:NP_611641.6 Gene:CG30280 / 37522 FlyBaseID:FBgn0050280 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_573254.1 Gene:CG6788 / 32773 FlyBaseID:FBgn0030880 Length:358 Species:Drosophila melanogaster


Alignment Length:261 Identity:96/261 - (36%)
Similarity:148/261 - (56%) Gaps:16/261 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LFGNLEAIYEQAENALSTLQESLLQLETNGT--LNTSPDVIYPTSCLTSG----DLENGLHTLKV 85
            |..|::.:..:..||.:.::...:|::.:..  ...|.:::  |.|....    |.:.|::.||:
  Fly   104 LIKNMKVLRSECLNAQAEIKSKDIQIQLSAAKIKQMSNELV--TQCSRQDTCPIDGKGGIYKLKI 166

  Fly    86 PGLSPFQVYCENQLAGPGWIVIQKRFSGNLSFFRNWKEYKNGFGNLMDEYFLGLEKIRALTALEP 150
            ..|..|:..|.:.    ||:.||||:.|..:|.|.||:||:|||.:..|:|:||||:..:|....
  Fly   167 RELPAFEAPCSSN----GWLTIQKRYDGAENFDRGWKDYKDGFGRVRGEFFIGLEKVHLMTRQRR 227

  Fly   151 HELYVHLEDFDDTIKHAKFDEFAIGNEDDDYAMNTLGKYSGTAGDSLRSHRKMKFSTYDRDNDHE 215
            ||||:.|...|.|..||.:|.|.:|.|.:.|.:.:||:|:||||||||.|.:.||:|.|:||| .
  Fly   228 HELYIKLGKIDGTTSHAHYDNFELGGEIESYELKSLGRYNGTAGDSLRPHERQKFTTNDKDND-A 291

  Fly   216 FNKNCAFYYLGGWWYNACLDSNLNGQYMPGGKYEESLFARGMCWRSWRGHNYGYRVT--QMMIRP 278
            :..|||....|||||..|..|.|||::...|:..... ..|:.|.||..:::.|.:|  :|||||
  Fly   292 YRFNCAADEYGGWWYYDCAKSMLNGKFYKEGRSRNGK-TNGILWGSWHNNDWTYSLTFVEMMIRP 355

  Fly   279 K 279
            :
  Fly   356 R 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30280NP_611641.6 FReD 65..279 CDD:238040 89/219 (41%)
CG6788NP_573254.1 FReD 160..356 CDD:238040 86/201 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467661
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H122246
Inparanoid 1 1.050 91 1.000 Inparanoid score I3666
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D84222at33392
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 1 1.000 - - otm14151
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
99.000

Return to query results.
Submit another query.