DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30280 and Fibcd1

DIOPT Version :9

Sequence 1:NP_611641.6 Gene:CG30280 / 37522 FlyBaseID:FBgn0050280 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_001101299.1 Gene:Fibcd1 / 311861 RGDID:1309097 Length:459 Species:Rattus norvegicus


Alignment Length:291 Identity:112/291 - (38%)
Similarity:155/291 - (53%) Gaps:60/291 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 LSTLQES---LLQL--ETNG----TLNTSPDVI-------------------------------- 65
            |||||..   |:||  |:.|    .:|:..||:                                
  Rat   170 LSTLQSEQGRLIQLLSESQGHMAHLVNSVSDVLEALQRERGLGRPRVKADLQRAPSRGARPRGCA 234

  Fly    66 ---YPTSC---LTSGDLENGLHTLKVPGLSP--FQVYCENQLAGPGWIVIQKRFSGNLSFFRNWK 122
               .|..|   |.||..::|:::: .|...|  |||||:.:..|.||.|.|:|..|:::|||.|:
  Rat   235 NGSRPRDCLDVLLSGQQDDGVYSV-FPTHYPAGFQVYCDMRTDGGGWTVFQRREDGSVNFFRGWE 298

  Fly   123 EYKNGFGNLMDEYFLGLEKIRALTALEPHELYVHLEDFDDTIKHAKFDEFAIG-----NEDDDYA 182
            .|:.|||.|..|::|||::|.|||....:||:|.|||||:...:|.:..|.:|     .|:|.|.
  Rat   299 AYREGFGKLTGEHWLGLKRIHALTTQAAYELHVDLEDFDNGTAYAHYGSFGVGLFSVDPEEDGYP 363

  Fly   183 MNTLGKYSGTAGDSLRSHRKMKFSTYDRDNDHEFNKNCAFYYLGGWWYNACLDSNLNGQYMPGGK 247
            : |:..|||||||||..|..|:|:|.|||:||..| |||.:|.|.|||..|..|||||||:.|  
  Rat   364 L-TVADYSGTAGDSLLKHSGMRFTTKDRDSDHSEN-NCAAFYRGAWWYRNCHTSNLNGQYLRG-- 424

  Fly   248 YEESLFARGMCWRSWRGHNYGYRVTQMMIRP 278
             ..:.:|.|:.|.||.|..|..:.::|.|||
  Rat   425 -PHASYADGVEWSSWTGWQYSLKFSEMKIRP 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30280NP_611641.6 FReD 65..279 CDD:238040 99/259 (38%)
Fibcd1NP_001101299.1 FReD 239..455 CDD:238040 99/222 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 186 1.000 Domainoid score I3251
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H122246
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D242508at33208
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 1 1.000 - - mtm12326
orthoMCL 1 0.900 - - OOG6_100073
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.920

Return to query results.
Submit another query.