DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30280 and tnn

DIOPT Version :9

Sequence 1:NP_611641.6 Gene:CG30280 / 37522 FlyBaseID:FBgn0050280 Length:288 Species:Drosophila melanogaster
Sequence 2:XP_005171321.1 Gene:tnn / 30234 ZFINID:ZDB-GENE-990415-262 Length:1020 Species:Danio rerio


Alignment Length:219 Identity:78/219 - (35%)
Similarity:118/219 - (53%) Gaps:15/219 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 YPTSC---LTSGDLENGLHTLKVPG--LSPFQVYCENQLAGPGWIVIQKRFSGNLSFFRNWKEYK 125
            :|..|   :.:|::|:|::|:.|..  ....||||:.:..|.||||.|:|.:|.:.|.:.|::|.
Zfish   793 FPMDCTQIMRNGNMESGVYTIYVNNNRSRTMQVYCDMKTDGGGWIVFQRRNTGKVDFMKKWRDYM 857

  Fly   126 NGFGNLMDEYFLGLEKIRALT-ALEPHELYVHLEDFDDTIKHAKFDEFAIGNEDDDYAMNTLGKY 189
            .|||.|.:|::|||:||..|| ....:|....|....|. |:|.:|.|.:......:.: |:|.|
Zfish   858 KGFGELTEEFWLGLDKIHELTNTPTQYEARFDLGSGSDR-KYAVYDNFKVAPSKQKFKL-TIGSY 920

  Fly   190 SGTAGDSLRSHRKMKFSTYDRDNDHEFNKNCAFYYLGGWWYNACLDSNLNGQYMPGGKYEESLFA 254
            .|.|||::..|:...|||.|.|||.... |||..:.|.|||..|..:||||::   |....|:  
Zfish   921 KGNAGDAMTYHQGAPFSTVDSDNDIALG-NCALTHQGAWWYKNCHLANLNGRF---GDNRHSM-- 979

  Fly   255 RGMCWRSWRGHNYGYRVTQMMIRP 278
             |:.|..|:||.......::.|||
Zfish   980 -GVNWEPWKGHLQSLDFAEIKIRP 1002

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30280NP_611641.6 FReD 65..279 CDD:238040 78/219 (36%)
tnnXP_005171321.1 EGF_alliinase <133..163 CDD:282688
EGF_2 161..189 CDD:285248
EGF_2 193..220 CDD:285248
EGF_2 224..251 CDD:285248
fn3 257..333 CDD:278470
fn3 344..426 CDD:278470
fn3 435..514 CDD:278470
fn3 523..602 CDD:278470
fn3 611..683 CDD:278470
fn3 699..773 CDD:278470
FReD 792..1003 CDD:238040 78/219 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100073
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.