DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30280 and tncb

DIOPT Version :9

Sequence 1:NP_611641.6 Gene:CG30280 / 37522 FlyBaseID:FBgn0050280 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_001299845.1 Gene:tncb / 30037 ZFINID:ZDB-GENE-980526-104 Length:1811 Species:Danio rerio


Alignment Length:222 Identity:89/222 - (40%)
Similarity:127/222 - (57%) Gaps:16/222 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 VIY--PTSC---LTSGDLENGLHTLKVPG--LSPFQVYCENQLAGPGWIVIQKRFSGNLSFFRNW 121
            |:|  |..|   |.:||..:||:|:.:.|  ..|.||||:....|.||||..:|.||.:.|||||
Zfish  1586 VLYKHPKDCSQALLNGDTTSGLYTIYLRGDESQPLQVYCDMTTDGGGWIVFVRRQSGKVEFFRNW 1650

  Fly   122 KEYKNGFGNLMDEYFLGLEKIRALTALEPHELYVHLEDFDDTIKHAKFDEFAIGNEDDDYAMNTL 186
            |.|..|||:|.||::|||..:..:|:...:||.|.|.|..:: .:|::|:|:|......|.:: :
Zfish  1651 KNYTAGFGDLNDEFWLGLSNLHKITSFGQYELRVDLRDKGES-AYAQYDKFSISEPRARYKVH-V 1713

  Fly   187 GKYSGTAGDSLRSHRKMKFSTYDRDNDHEFNKNCAFYYLGGWWYNACLDSNLNGQYMPGGKYEES 251
            |.||||||||:..|....|||||.|||.... |||..|.|.:||..|...|:.      |:|.::
Zfish  1714 GGYSGTAGDSMTYHHGRPFSTYDNDNDIAVT-NCALSYKGAFWYKNCHRVNIM------GRYGDN 1771

  Fly   252 LFARGMCWRSWRGHNYGYRVTQMMIRP 278
            ..::|:.|..|:||.:.....:|.|||
Zfish  1772 SHSKGVNWFHWKGHEHSVEFAEMKIRP 1798

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30280NP_611641.6 FReD 65..279 CDD:238040 88/221 (40%)
tncbNP_001299845.1 DnaJ <471..>544 CDD:333066
fn3 689..760 CDD:306538
fn3 778..858 CDD:306538
fn3 868..948 CDD:306538
FN3 958..1047 CDD:238020
fn3 1050..1128 CDD:306538
fn3 1140..1215 CDD:306538
fn3 1231..1303 CDD:306538
fn3 1323..1400 CDD:306538
fn3 1410..1482 CDD:306538
fn3 1498..1570 CDD:306538
FReD 1589..1798 CDD:238040 85/217 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100073
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.