DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30280 and Angptl6

DIOPT Version :9

Sequence 1:NP_611641.6 Gene:CG30280 / 37522 FlyBaseID:FBgn0050280 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_001100172.1 Gene:Angptl6 / 298698 RGDID:1311141 Length:457 Species:Rattus norvegicus


Alignment Length:205 Identity:86/205 - (41%)
Similarity:122/205 - (59%) Gaps:4/205 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 SGDLENGLHTLKVPGLSPFQVYCENQLAGPGWIVIQKRFSGNLSFFRNWKEYKNGFGNLMDEYFL 137
            :|..::|::.|:: |.....|:||.|..|.||.|||:|..|:::||.||:.||.|||....||:|
  Rat   253 AGHWQSGVYELRL-GRRVVPVWCEQQQEGGGWTVIQRRQDGSVNFFTNWQHYKVGFGRPDGEYWL 316

  Fly   138 GLEKIRALTALEPHELYVHLEDFDDTIKHAKFDEFAIGNEDDDYAMNTLGKYSGTAGDSLRSHRK 202
            |||.:..:|:...|||.:.|:|:......|.:|.|::..|.|.|.:. ||:|.|.|||||..|..
  Rat   317 GLEPVHQVTSRGDHELLILLKDWGGRGARAHYDSFSLEPESDHYRLR-LGQYHGDAGDSLSWHSD 380

  Fly   203 MKFSTYDRDNDHEFNKNCAFYYLGGWWYNACLDSNLNGQYMPGGKYEESLFARGMCWRSWRGHNY 267
            ..|:|.|||.| .::.|||.|:.|||||:||..|||||.:..||.| .|.:..|:.|..:||..|
  Rat   381 KPFNTVDRDRD-SYSGNCALYHRGGWWYHACAHSNLNGVWYHGGHY-RSRYQDGVYWAEFRGGAY 443

  Fly   268 GYRVTQMMIR 277
            ..:...|:.|
  Rat   444 SLKKAAMLTR 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30280NP_611641.6 FReD 65..279 CDD:238040 86/205 (42%)
Angptl6NP_001100172.1 Uso1_p115_C 66..>157 CDD:282695
FReD 242..453 CDD:238040 85/203 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X25
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.