DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30280 and Angpt4

DIOPT Version :9

Sequence 1:NP_611641.6 Gene:CG30280 / 37522 FlyBaseID:FBgn0050280 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_001099996.1 Gene:Angpt4 / 296269 RGDID:1307539 Length:508 Species:Rattus norvegicus


Alignment Length:300 Identity:93/300 - (31%)
Similarity:145/300 - (48%) Gaps:53/300 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 HAETLNLFGN----LEAIYEQAENALSTLQESLLQLETN-GTLNTSPDVI--------------- 65
            |...||...:    |:::......||:.|:.||..|.:| .:|......:               
  Rat   217 HQAQLNSLQDKREQLQSLLGHQTGALANLKHSLRALSSNSSSLQQQQQQLMELVQRLVRIVAQDQ 281

  Fly    66 YPTSCLT-------------SGDLENGLHTLKVPGLS-PFQVYCENQLAGPGWIVIQKRFSGNLS 116
            :|.|..|             ||...:|::|:....:: |.:|:|:.:..|.||.:||:|..|:|:
  Rat   282 HPVSLKTPKPLFRDCAEIKRSGANTSGVYTIHGANMTKPLKVFCDMETDGGGWTLIQRREDGSLN 346

  Fly   117 FFRNWKEYKNGFGNLMDEYFLGLEKIRALTALEPHELYVHLEDFDDTIKHAKFDEFAIGNEDDDY 181
            |.|.|:|||.||||:..|::||.|.:.:||:...:.|.|.|.|::......:::.|.:|:|..  
  Rat   347 FQRTWEEYKEGFGNVAREHWLGNEAVHSLTSRTAYLLRVELHDWEGHQTSIQYENFQLGSERQ-- 409

  Fly   182 AMNTLGKYSGTAGDSLRSHR--------KMKFSTYDRDNDHEFNKNCAFYYLGGWWYNACLDSNL 238
                  :||.:..||..|.|        ..||||.|.|||:...| ||....||||::||..|||
  Rat   410 ------RYSLSVNDSSISARLKNSLAPQGTKFSTKDMDNDNCMCK-CAQMLSGGWWFDACGLSNL 467

  Fly   239 NGQYMPGGKYEESLFARGMCWRSWRGHNYGYRVTQMMIRP 278
            ||.|.|..::...:  .|:.|..:||.:|....|:||:||
  Rat   468 NGIYYPVHQHLHKI--NGIRWHYFRGPSYSLHGTRMMLRP 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30280NP_611641.6 FReD 65..279 CDD:238040 80/250 (32%)
Angpt4NP_001099996.1 FReD 291..506 CDD:238040 77/225 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.