DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30280 and ANGPT2

DIOPT Version :9

Sequence 1:NP_611641.6 Gene:CG30280 / 37522 FlyBaseID:FBgn0050280 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_001138.1 Gene:ANGPT2 / 285 HGNCID:485 Length:496 Species:Homo sapiens


Alignment Length:279 Identity:97/279 - (34%)
Similarity:142/279 - (50%) Gaps:31/279 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LFGNLEAIYEQAENAL--STLQESLLQ------LETNGTL----NTSPDVIYPT----------S 69
            |.....:|.|:.|..:  :|:..|:||      :||...|    :||.....||          .
Human   219 LVSKQNSIIEELEKKIVTATVNNSVLQKQQHDLMETVNNLLTMMSTSNSAKDPTVAKEEQISFRD 283

  Fly    70 C---LTSGDLENGLHTLKVP-GLSPFQVYCENQLAGPGWIVIQKRFSGNLSFFRNWKEYKNGFGN 130
            |   ..||...||::||..| .....:.||:.:..|.||.:||:|..|::.|.|.|||||.||||
Human   284 CAEVFKSGHTTNGIYTLTFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGN 348

  Fly   131 LMDEYFLGLEKIRALTALEPHELYVHLEDFDDTIKHAKFDEFAIGNEDDDYAMNTLGKYSGTAGD 195
            ...||:||.|.:..||..:.:.|.:||:|::....::.::.|.:.:|:.:|.::..| .:||||.
Human   349 PSGEYWLGNEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKG-LTGTAGK 412

  Fly   196 -SLRSHRKMKFSTYDRDNDHEFNKNCAFYYLGGWWYNACLDSNLNGQYMPGGKYEESLFARGMCW 259
             |..|.....|||.|.|||....| |:....||||::||..|||||.|.|  :.:.:....|:.|
Human   413 ISSISQPGNDFSTKDGDNDKCICK-CSQMLTGGWWFDACGPSNLNGMYYP--QRQNTNKFNGIKW 474

  Fly   260 RSWRGHNYGYRVTQMMIRP 278
            ..|:|..|..:.|.|||||
Human   475 YYWKGSGYSLKATTMMIRP 493

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30280NP_611641.6 FReD 65..279 CDD:238040 84/229 (37%)
ANGPT2NP_001138.1 SMC_N <78..>295 CDD:330553 18/75 (24%)
FBG 280..494 CDD:214548 82/218 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm41874
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.