DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30280 and ANGPT1

DIOPT Version :9

Sequence 1:NP_611641.6 Gene:CG30280 / 37522 FlyBaseID:FBgn0050280 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_001137.2 Gene:ANGPT1 / 284 HGNCID:484 Length:498 Species:Homo sapiens


Alignment Length:298 Identity:101/298 - (33%)
Similarity:148/298 - (49%) Gaps:47/298 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 HAETLNLF----GNLEA-------IYEQAENAL--STLQESLLQLETNGTLNTSPDVIYPTSCLT 72
            |.|.|:..    .||:.       |.::.|..|  :|...|:||.:....::|..:::  ..|..
Human   205 HKEELDTLKEEKENLQGLVTRQTYIIQELEKQLNRATTNNSVLQKQQLELMDTVHNLV--NLCTK 267

  Fly    73 SGDL------------------------ENGLHTLKVPGL-SPFQVYCENQLAGPGWIVIQKRFS 112
            .|.|                        ::|::|:.:..: .|.:|:|...:.|.||.|||.|..
Human   268 EGVLLKGGKREEEKPFRDCADVYQAGFNKSGIYTIYINNMPEPKKVFCNMDVNGGGWTVIQHRED 332

  Fly   113 GNLSFFRNWKEYKNGFGNLMDEYFLGLEKIRALTALEPHELYVHLEDFDDTIKHAKFDEFAIGNE 177
            |:|.|.|.|||||.||||...||:||.|.|.|:|:...:.|.:.|.|::....::::|.|.||||
Human   333 GSLDFQRGWKEYKMGFGNPSGEYWLGNEFIFAITSQRQYMLRIELMDWEGNRAYSQYDRFHIGNE 397

  Fly   178 DDDYAMNTLGKYSGTAG--DSLRSHRKMKFSTYDRDNDHEFNKNCAFYYLGGWWYNACLDSNLNG 240
            ..:|.:...| ::||||  .||..| ...|||.|.|||:...| ||....||||::||..|||||
Human   398 KQNYRLYLKG-HTGTAGKQSSLILH-GADFSTKDADNDNCMCK-CALMLTGGWWFDACGPSNLNG 459

  Fly   241 QYMPGGKYEESLFARGMCWRSWRGHNYGYRVTQMMIRP 278
            .:...|:....|  .|:.|..::|.:|..|.|.|||||
Human   460 MFYTAGQNHGKL--NGIKWHYFKGPSYSLRSTTMMIRP 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30280NP_611641.6 FReD 65..279 CDD:238040 88/241 (37%)
ANGPT1NP_001137.2 Smc <81..280 CDD:224117 16/76 (21%)
FReD 281..496 CDD:238040 85/220 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm41874
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.