DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30280 and ANGPTL3

DIOPT Version :9

Sequence 1:NP_611641.6 Gene:CG30280 / 37522 FlyBaseID:FBgn0050280 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_055310.1 Gene:ANGPTL3 / 27329 HGNCID:491 Length:460 Species:Homo sapiens


Alignment Length:270 Identity:87/270 - (32%)
Similarity:138/270 - (51%) Gaps:21/270 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 HAETLNLFGNLE--AIYEQAENALSTLQES-----LLQLETNGTLNTSPDVIYPTSCLT---SGD 75
            |::...:...|.  :|.|..|.:||:...:     .|||  |...|...|.| |..|.|   .|:
Human   193 HSQIKEIENQLRRTSIQEPTEISLSSKPRAPRTTPFLQL--NEIRNVKHDGI-PAECTTIYNRGE 254

  Fly    76 LENGLHTLKVPGLSPFQVYCENQLAGPGWIVIQKRFSGNLSFFRNWKEYKNGFGNLMDEYFLGLE 140
            ..:|::.::......|.|||: .::|..|.:||.|..|:.:|...|:.||.|||.|..|::||||
Human   255 HTSGMYAIRPSNSQVFHVYCD-VISGSPWTLIQHRIDGSQNFNETWENYKYGFGRLDGEFWLGLE 318

  Fly   141 KIRALTALEPHELYVHLEDFDDTIKHAKFDEFAIGNEDDDYAMNTLGKYSGTAGDSLRSHRKMKF 205
            ||.::.....:.|.:.|||:.|. ||.....|.:||.:.:|.:: |...:|...:::..::.:.|
Human   319 KIYSIVKQSNYVLRIELEDWKDN-KHYIEYSFYLGNHETNYTLH-LVAITGNVPNAIPENKDLVF 381

  Fly   206 STYDRDNDHEFNKNCAFYYLGG-WWYNACLDSNLNGQY-MPGGKYEESLFARGMCWRSWRGHNYG 268
            ||:|......|  ||...|.|| ||::.|.::||||:| .|..|.:... .||:.|:|..|..|.
Human   382 STWDHKAKGHF--NCPEGYSGGWWWHDECGENNLNGKYNKPRAKSKPER-RRGLSWKSQNGRLYS 443

  Fly   269 YRVTQMMIRP 278
            .:.|:|:|.|
Human   444 IKSTKMLIHP 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30280NP_611641.6 FReD 65..279 CDD:238040 74/219 (34%)
ANGPTL3NP_055310.1 SMC_N <84..>215 CDD:330553 5/21 (24%)
FReD 243..453 CDD:238040 72/215 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.