DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30280 and Fgl1

DIOPT Version :9

Sequence 1:NP_611641.6 Gene:CG30280 / 37522 FlyBaseID:FBgn0050280 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_742007.2 Gene:Fgl1 / 246186 RGDID:620169 Length:314 Species:Rattus norvegicus


Alignment Length:220 Identity:90/220 - (40%)
Similarity:126/220 - (57%) Gaps:20/220 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 GDLENGLHTLK-VPGLSPFQVYCENQLAGPGWIVIQKRFSGNLSFFRNWKEYKNGFGNLMD---E 134
            |...:|.:.:| :..|:.|.|||: ...|.||.|||:|..|:.:|.|.|.:|:|||||.:.   |
  Rat    92 GFKHSGFYKIKPLQSLAEFSVYCD-MSDGGGWTVIQRRSDGSENFNRGWNDYENGFGNFVQSNGE 155

  Fly   135 YFLGLEKIRALTALEPHELYVHLEDFDDTIKHAKFDEFAIGNEDDDYAMNTLGKYSGTAGDSL-- 197
            |:||.:.|..||....:.|.:.|.||:...:.|::::|.:|:|...|.:| :|:|||||||||  
  Rat   156 YWLGNKNINLLTMQGDYTLKIDLTDFEKNSRFAQYEKFKVGDEKSFYELN-IGEYSGTAGDSLSG 219

  Fly   198 ---------RSHRKMKFSTYDRDNDHEFNKNCAFYYLGGWWYNACLDSNLNGQYMPGGKYEESLF 253
                     .||:.|||||.|||||: :|.|||.....|||:|.|..:||||.|..|....|:  
  Rat   220 TFHPEVQWWASHQTMKFSTRDRDNDN-YNGNCAEEEQSGWWFNRCHSANLNGVYYQGPYRAET-- 281

  Fly   254 ARGMCWRSWRGHNYGYRVTQMMIRP 278
            ..|:.|.:|||..|..:...|.|||
  Rat   282 DNGVVWYTWRGWWYSLKSVVMKIRP 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30280NP_611641.6 FReD 65..279 CDD:238040 90/220 (41%)
Fgl1NP_742007.2 FReD 80..306 CDD:238040 88/218 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D242508at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm12326
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X25
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.