DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30280 and Fgb

DIOPT Version :9

Sequence 1:NP_611641.6 Gene:CG30280 / 37522 FlyBaseID:FBgn0050280 Length:288 Species:Drosophila melanogaster
Sequence 2:XP_038957639.1 Gene:Fgb / 24366 RGDID:2604 Length:504 Species:Rattus norvegicus


Alignment Length:278 Identity:92/278 - (33%)
Similarity:135/278 - (48%) Gaps:47/278 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 LEAIYEQAENALSTLQESL-LQLE---TNGTLNTSPDVIYPTSC---LTSGDLENGLHTLKVPGL 88
            |.:|.|...:.:..|:..: .|.|   |..|:|.:..|:....|   :..|...:.::.:: |..
  Rat   186 LRSILEDLRSKIQKLESDISAQTEYCHTPCTVNCNIPVVSGKECEEIIRKGGETSEMYLIQ-PDT 249

  Fly    89 S--PFQVYCENQLAGPGWIVIQKRFSGNLSFFRNWKEYKNGFGN------------LMDEYFLGL 139
            |  |::|||:.:....||.|||.|..|::.|.|.|..||.||||            |..||:||.
  Rat   250 SSKPYRVYCDMKTENGGWTVIQNRQDGSVDFGRKWDPYKKGFGNIATNEDTKKYCGLPGEYWLGN 314

  Fly   140 EKIRALTALEPHELYVHLEDF-DDTIKHAKFDEFAIGNEDDDYAMNTLGKYSGTAGDSLRS---- 199
            :||..||.:.|.||.:.:||: .|.:| |.:..|.:..|.:.|.: ::.||.||||::|..    
  Rat   315 DKISQLTRIGPTELLIEMEDWKGDKVK-AHYGGFTVQTEANKYQV-SVNKYKGTAGNALMEGASQ 377

  Fly   200 ----------HRKMKFSTYDRDND----HEFNKNCAFYYLGGWWYNACLDSNLNGQYMPGGKYEE 250
                      |..|.|||||||||    .:..|.|:....||||||.|..:|.||:|..||.|..
  Rat   378 LVGENRTMTIHNGMFFSTYDRDNDGWVTTDPRKQCSKEDGGGWWYNRCHAANPNGRYYWGGLYSW 442

  Fly   251 SLFAR----GMCWRSWRG 264
            .:...    |:.|.:|:|
  Rat   443 DMSKHGTDDGVVWMNWKG 460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30280NP_611641.6 FReD 65..279 CDD:238040 82/240 (34%)
FgbXP_038957639.1 Fib_alpha 80..222 CDD:400857 9/35 (26%)
FReD 225..462 CDD:412152 82/239 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.