DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30280 and ANGPTL2

DIOPT Version :9

Sequence 1:NP_611641.6 Gene:CG30280 / 37522 FlyBaseID:FBgn0050280 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_036230.1 Gene:ANGPTL2 / 23452 HGNCID:490 Length:493 Species:Homo sapiens


Alignment Length:252 Identity:100/252 - (39%)
Similarity:140/252 - (55%) Gaps:17/252 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 QAENALSTLQESLLQLETNGTLNTSPDVIYPT----SCLTSGDLENGLHTLKVPGLSP------F 91
            |::..|..|...|..:.|..:|.:|.|  .|:    .||.:  ||:|..|..:..:.|      .
Human   243 QSDQNLKVLPPPLPTMPTLTSLPSSTD--KPSGPWRDCLQA--LEDGHDTSSIYLVKPENTNRLM 303

  Fly    92 QVYCENQLAGPGWIVIQKRFSGNLSFFRNWKEYKNGFGNLMDEYFLGLEKIRALTALEPHELYVH 156
            ||:|:.:....||.|||:|..|:::|||||:.||.||||:..||:||||.|..||....::|.|.
Human   304 QVWCDQRHDPGGWTVIQRRLDGSVNFFRNWETYKQGFGNIDGEYWLGLENIYWLTNQGNYKLLVT 368

  Fly   157 LEDFDDTIKHAKFDEFAIGNEDDDYAMNTLGKYSGTAGDSLRSHRKMKFSTYDRDNDHEFNKNCA 221
            :||:......|::..|.:..|.:.|.:. ||:|.|.||||...|...:|:|.|||:| .:..|||
Human   369 MEDWSGRKVFAEYASFRLEPESEYYKLR-LGRYHGNAGDSFTWHNGKQFTTLDRDHD-VYTGNCA 431

  Fly   222 FYYLGGWWYNACLDSNLNGQYMPGGKYEESLFARGMCWRSWRGHNYGYRVTQMMIRP 278
            .|..||||||||..|||||.:..||.| .|.:..|:.|..:||.:|..:...|||||
Human   432 HYQKGGWWYNACAHSNLNGVWYRGGHY-RSRYQDGVYWAEFRGGSYSLKKVVMMIRP 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30280NP_611641.6 FReD 65..279 CDD:238040 92/224 (41%)
ANGPTL2NP_036230.1 FReD 273..487 CDD:238040 89/218 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 186 1.000 Domainoid score I3350
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm40314
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.