DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30280 and Fgl1

DIOPT Version :9

Sequence 1:NP_611641.6 Gene:CG30280 / 37522 FlyBaseID:FBgn0050280 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_663569.2 Gene:Fgl1 / 234199 MGIID:102795 Length:314 Species:Mus musculus


Alignment Length:309 Identity:104/309 - (33%)
Similarity:155/309 - (50%) Gaps:50/309 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VCIALSVMI----------FCHAETLNL---FGNLEAIYEQAENALS-TLQESLLQLETNGTLNT 60
            |.:|:::|:          .|..|.:.|   ...||...:|.:..:: .|.|..:|....|:.|:
Mouse     8 VLVAIALMMGREGWALESENCLREQVRLRAQVHQLETRVKQQQTMIAQLLHEKEVQFLDKGSENS 72

  Fly    61 SPDV-----------IYPTSCLTSGDLENGLHTLK-VPGLSPFQVYCENQLAGPGWIVIQKRFSG 113
            ..|:           ||     ..|..::|.:.:| :..|:.|.|||: ...|.||.|||:|..|
Mouse    73 FIDLGGKKQYADCSEIY-----NDGFKQSGFYKIKPLQSLAEFSVYCD-MSDGGGWTVIQRRSDG 131

  Fly   114 NLSFFRNWKEYKNGFGNLMD---EYFLGLEKIRALTALEPHELYVHLEDFDDTIKHAKFDEFAIG 175
            :.:|.|.|.:|:|||||.:.   ||:||.:.|..||....:.|.:.|.||:.....|::..|.:|
Mouse   132 SENFNRGWNDYENGFGNFVQNNGEYWLGNKNINLLTIQGDYTLKIDLTDFEKNSSFAQYQSFKVG 196

  Fly   176 NEDDDYAMNTLGKYSGTAGDSL-----------RSHRKMKFSTYDRDNDHEFNKNCAFYYLGGWW 229
            ::...|.:| :|:|||||||||           .||::|||||:|||||: :..|||.....|||
Mouse   197 DKKSFYELN-IGEYSGTAGDSLSGTFHPEVQWWASHQRMKFSTWDRDNDN-YQGNCAEEEQSGWW 259

  Fly   230 YNACLDSNLNGQYMPGGKYEESLFARGMCWRSWRGHNYGYRVTQMMIRP 278
            :|.|..:||||.|..|....|:  ..|:.|.:|.|..|..:...|.|||
Mouse   260 FNRCHSANLNGVYYRGSYRAET--DNGVVWYTWHGWWYSLKSVVMKIRP 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30280NP_611641.6 FReD 65..279 CDD:238040 89/229 (39%)
Fgl1NP_663569.2 FReD 80..306 CDD:238040 87/235 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D242508at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.