DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30280 and FGB

DIOPT Version :9

Sequence 1:NP_611641.6 Gene:CG30280 / 37522 FlyBaseID:FBgn0050280 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_005132.2 Gene:FGB / 2244 HGNCID:3662 Length:491 Species:Homo sapiens


Alignment Length:304 Identity:101/304 - (33%)
Similarity:147/304 - (48%) Gaps:50/304 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 ETL--NLFGNLEAIYEQAENALSTLQ----ESLLQLE---TNGTLNTSPDVIYPTSC---LTSGD 75
            ||:  |:..||..:....||..|.:|    :...|:|   |..|::.:..|:....|   :..|.
Human   185 ETVNSNIPTNLRVLRSILENLRSKIQKLESDVSAQMEYCRTPCTVSCNIPVVSGKECEEIIRKGG 249

  Fly    76 LENGLHTLKV-PGLSPFQVYCENQLAGPGWIVIQKRFSGNLSFFRNWKEYKNGFGN--------- 130
            ..:.::.::. ..:.|::|||:......||.|||.|..|::.|.|.|..||.||||         
Human   250 ETSEMYLIQPDSSVKPYRVYCDMNTENGGWTVIQNRQDGSVDFGRKWDPYKQGFGNVATNTDGKN 314

  Fly   131 ---LMDEYFLGLEKIRALTALEPHELYVHLEDF-DDTIKHAKFDEFAIGNEDDDYAMNTLGKYSG 191
               |..||:||.:||..||.:.|.||.:.:||: .|.:| |.:..|.:.||.:.|.: ::.||.|
Human   315 YCGLPGEYWLGNDKISQLTRMGPTELLIEMEDWKGDKVK-AHYGGFTVQNEANKYQI-SVNKYRG 377

  Fly   192 TAGDSLRS--------------HRKMKFSTYDRDND----HEFNKNCAFYYLGGWWYNACLDSNL 238
            |||::|..              |..|.|||||||||    .:..|.|:....||||||.|..:|.
Human   378 TAGNALMDGASQLMGENRTMTIHNGMFFSTYDRDNDGWLTSDPRKQCSKEDGGGWWYNRCHAANP 442

  Fly   239 NGQYMPGGKYEESLFAR----GMCWRSWRGHNYGYRVTQMMIRP 278
            ||:|..||:|...:...    |:.|.:|:|..|..|...|.|||
Human   443 NGRYYWGGQYTWDMAKHGTDDGVVWMNWKGSWYSMRKMSMKIRP 486

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30280NP_611641.6 FReD 65..279 CDD:238040 87/253 (34%)
FGBNP_005132.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 44..75
Beta-chain polymerization, binding distal domain of another fibrin 45..47
Fib_alpha 92..234 CDD:312286 13/48 (27%)
FReD 237..486 CDD:294064 85/250 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.