DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30280 and FGA

DIOPT Version :9

Sequence 1:NP_611641.6 Gene:CG30280 / 37522 FlyBaseID:FBgn0050280 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_000499.1 Gene:FGA / 2243 HGNCID:3661 Length:866 Species:Homo sapiens


Alignment Length:272 Identity:99/272 - (36%)
Similarity:146/272 - (53%) Gaps:38/272 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 YEQAENALSTLQESLLQLETNGTLNTSP-----DVI--YPTSCLTSGDLENGLHTLKVPGLSP-F 91
            |:.|:.|.|............|...:.|     ||:  :|:.      .::|:..:|:||.|. |
Human   601 YKMADEAGSEADHEGTHSTKRGHAKSRPVRDCDDVLQTHPSG------TQSGIFNIKLPGSSKIF 659

  Fly    92 QVYCENQLAGPGWIVIQKRFSGNLSFFRNWKEYKNGFGNLMD----EYFLGLEKIRALTALEPHE 152
            .|||:.:.:..||::||:|..|:|:|.|.|::||.|||:|.|    |::||.:.:..||. ....
Human   660 SVYCDQETSLGGWLLIQQRMDGSLNFNRTWQDYKRGFGSLNDEGEGEFWLGNDYLHLLTQ-RGSV 723

  Fly   153 LYVHLEDFDDTIKHAKFDEFAIGNEDDDYAMNTLGKYSGTAGDSL-----------RSHRKMKFS 206
            |.|.|||:.....:|:: .|.:|:|.:.||:. :..|.|||||:|           .||..|:||
Human   724 LRVELEDWAGNEAYAEY-HFRVGSEAEGYALQ-VSSYEGTAGDALIEGSVEEGAEYTSHNNMQFS 786

  Fly   207 TYDRDNDHEFNKNCAFYYLGGWWYNACLDSNLNGQYMPGGKYEES-----LFARGMCWRSWRGHN 266
            |:|||.| ::.:|||..|.||||||.|..:||||.|.|||.|:..     ....|:.|.|:||.:
Human   787 TFDRDAD-QWEENCAEVYGGGWWYNNCQAANLNGIYYPGGSYDPRNNSPYEIENGVVWVSFRGAD 850

  Fly   267 YGYRVTQMMIRP 278
            |..|..:|.|||
Human   851 YSLRAVRMKIRP 862

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30280NP_611641.6 FReD 65..279 CDD:238040 91/237 (38%)
FGANP_000499.1 Alpha-chain polymerization, binding distal domain of another fibrin gamma chain 36..38
Fib_alpha 50..187 CDD:285864
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 262..460
Fibrinogen_aC 445..509 CDD:288972
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 543..638 8/36 (22%)
FReD 630..863 CDD:238040 93/243 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.