DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30280 and FCN2

DIOPT Version :9

Sequence 1:NP_611641.6 Gene:CG30280 / 37522 FlyBaseID:FBgn0050280 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_004099.2 Gene:FCN2 / 2220 HGNCID:3624 Length:313 Species:Homo sapiens


Alignment Length:223 Identity:91/223 - (40%)
Similarity:126/223 - (56%) Gaps:16/223 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 PTSCLTS----------GDLENGLHTLKVPGLSPFQVYCENQLAGPGWIVIQKRFSGNLSFFRNW 121
            |..|||.          |...:|.||:.:|...|..|.|:....|.||.|.|:|..|::.|:|:|
Human    95 PQPCLTGPRTCKDLLDRGHFLSGWHTIYLPDCRPLTVLCDMDTDGGGWTVFQRRVDGSVDFYRDW 159

  Fly   122 KEYKNGFGNLMDEYFLGLEKIRALTALEPHELYVHLEDFDDTIKHAKFDEFAIGNEDDDYAMNTL 186
            ..||.|||:.:.|::||.:.|.||||....||.|.|.||:|..:.||:..|.:.:|.:.|.: .|
Human   160 ATYKQGFGSRLGEFWLGNDNIHALTAQGTSELRVDLVDFEDNYQFAKYRSFKVADEAEKYNL-VL 223

  Fly   187 GKY-SGTAGDSLRSHRKMKFSTYDRDNDHEFNKNCAFYYLGGWWYNACLDSNLNGQYMPGGKYEE 250
            |.: .|:|||||..|....|||.|:|||.. ..|||..:.|.|||..|..|||||:|:.|   ..
Human   224 GAFVEGSAGDSLTFHNNQSFSTKDQDNDLN-TGNCAVMFQGAWWYKNCHVSNLNGRYLRG---TH 284

  Fly   251 SLFARGMCWRSWRGHNYGYRVTQMMIRP 278
            ..||.|:.|:|.:|:||.|:|::|.:||
Human   285 GSFANGINWKSGKGYNYSYKVSEMKVRP 312

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG30280NP_611641.6 FReD 65..279 CDD:238040 91/223 (41%)
FCN2NP_004099.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 51..99 1/3 (33%)
FReD 102..312 CDD:238040 85/214 (40%)