DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30280 and Fcnb

DIOPT Version :9

Sequence 1:NP_611641.6 Gene:CG30280 / 37522 FlyBaseID:FBgn0050280 Length:288 Species:Drosophila melanogaster
Sequence 2:XP_006497739.1 Gene:Fcnb / 14134 MGIID:1341158 Length:322 Species:Mus musculus


Alignment Length:222 Identity:67/222 - (30%)
Similarity:98/222 - (44%) Gaps:33/222 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 PTSC---LTSGDLENGLHTLKVPGLSPFQVYCENQLAGPGWIVIQKRFSGNLSFFRNWKEYKNGF 128
            |.:|   ||.|....|.:|:.:|...|..|.|:....|.||.|.|:|..|::.|||:|..||.||
Mouse   103 PRTCKELLTQGHFLTGWYTIYLPDCRPLTVLCDMDTDGGGWTVFQRRLDGSVDFFRDWTSYKRGF 167

  Fly   129 GNLMDEYFLGLEKIRALTALEPHELYVHLEDFDDTIKHAKFDEFAIGNEDDDYAM---NTLGKYS 190
            |:.:.|::||.:.|.|||.....||.|.|.||:.....||:..|.|..|.:.|.:   |.||..:
Mouse   168 GSQLGEFWLGNDNIHALTTQGTSELRVDLSDFEGKHDFAKYSSFQIQGEAEKYKLILGNFLGGGA 232

  Fly   191 GTAGDSLRSHRKMKFSTYDR----DNDHEFNKNC------AFYYLGGWWYNACLDSNLNGQYMPG 245
            |.|..|:...:.:..:...|    .::|...|.|      :.|..    :..|..|         
Mouse   233 GPAFPSVTISQNLSVTNPLRSQISQSNHLTLKQCLPSTKPSTYNT----FRGCFIS--------- 284

  Fly   246 GKYEESLFARGMCW---RSWRGHNYGY 269
             |.::.:|.|..|.   .|:|.|...|
Mouse   285 -KPQQHVFPRRTCGLGSASYRVHPTAY 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30280NP_611641.6 FReD 65..279 CDD:238040 67/222 (30%)
FcnbXP_006497739.1 Collagen 40..95 CDD:189968
FReD 103..>238 CDD:238040 51/134 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 187 1.000 Domainoid score I3330
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 189 1.000 Inparanoid score I3887
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 1 1.000 - - otm42379
orthoMCL 1 0.900 - - OOG6_100073
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.860

Return to query results.
Submit another query.