DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30280 and Fcna

DIOPT Version :9

Sequence 1:NP_611641.6 Gene:CG30280 / 37522 FlyBaseID:FBgn0050280 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_032021.1 Gene:Fcna / 14133 MGIID:1340905 Length:334 Species:Mus musculus


Alignment Length:215 Identity:93/215 - (43%)
Similarity:129/215 - (60%) Gaps:9/215 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 PTSC---LTSGDLENGLHTLKVPGLSPFQVYCENQLAGPGWIVIQKRFSGNLSFFRNWKEYKNGF 128
            |.||   ||.|....|.:|:.:|...|..|.|:..:.|.||.|.|:|..|::.|||:|..||.||
Mouse   123 PRSCKDLLTRGIFLTGWYTIHLPDCRPLTVLCDMDVDGGGWTVFQRRVDGSIDFFRDWDSYKRGF 187

  Fly   129 GNLMDEYFLGLEKIRALTALEPHELYVHLEDFDDTIKHAKFDEFAIGNEDDDYAMNTLGKY-SGT 192
            |||..|::||.:.:..|||....||.|.|:||.....:||:..|.:..|.:.|.: |||:: .||
Mouse   188 GNLGTEFWLGNDYLHLLTANGNQELRVDLQDFQGKGSYAKYSSFQVSEEQEKYKL-TLGQFLEGT 251

  Fly   193 AGDSLRSHRKMKFSTYDRDNDHEFNKNCAFYYLGGWWYNACLDSNLNGQYMPGGKYEESLFARGM 257
            |||||..|..|.|:|:|:|||.. :.|||..:.|.|||:.|..|||||:|:.|.  .|| :|.|:
Mouse   252 AGDSLTKHNNMSFTTHDQDNDAN-SMNCAALFHGAWWYHNCHQSNLNGRYLSGS--HES-YADGI 312

  Fly   258 CWRSWRGHNYGYRVTQMMIR 277
            .|.:.:||:|.|:|.:|.||
Mouse   313 NWGTGQGHHYSYKVAEMKIR 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30280NP_611641.6 FReD 65..279 CDD:238040 93/215 (43%)
FcnaNP_032021.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 47..117
Collagen 65..106 CDD:189968
FReD 123..332 CDD:238040 91/213 (43%)
A domain, contributes to trimerization. /evidence=ECO:0000250 123..162 13/38 (34%)
B domain, contributes to trimerization. /evidence=ECO:0000250 163..251 36/88 (41%)
Carbohydrate-binding. /evidence=ECO:0000250|UniProtKB:O00602 290..292 0/1 (0%)
P domain. /evidence=ECO:0000250|UniProtKB:O00602 325..334 4/8 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 187 1.000 Domainoid score I3330
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 189 1.000 Inparanoid score I3887
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 1 1.000 - - otm43211
orthoMCL 1 0.900 - - OOG6_100073
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.860

Return to query results.
Submit another query.