DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30280 and Angpt2

DIOPT Version :9

Sequence 1:NP_611641.6 Gene:CG30280 / 37522 FlyBaseID:FBgn0050280 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_031452.2 Gene:Angpt2 / 11601 MGIID:1202890 Length:496 Species:Mus musculus


Alignment Length:296 Identity:99/296 - (33%)
Similarity:143/296 - (48%) Gaps:42/296 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 HAETLN-----------LFGNLEAIYEQAENAL--STLQESLLQLETNGTLNTSPDVI----YPT 68
            |:|.|.           |.....::.::.|..|  :|:..||||.:.:..:.|...::    .|.
Mouse   202 HSEQLQSMKEQKDELQVLVSKQSSVIDELEKKLVTATVNNSLLQKQQHDLMETVNSLLTMMSSPN 266

  Fly    69 S----------------C---LTSGDLENGLHTLKVP-GLSPFQVYCENQLAGPGWIVIQKRFSG 113
            |                |   ..||...:|::||..| .....:.||:..:.|.||.|||.|..|
Mouse   267 SKSSVAIRKEEQTTFRDCAEIFKSGLTTSGIYTLTFPNSTEEIKAYCDMDVGGGGWTVIQHREDG 331

  Fly   114 NLSFFRNWKEYKNGFGNLMDEYFLGLEKIRALTALEPHELYVHLEDFDDTIKHAKFDEFAIGNED 178
            ::.|.|.|||||.|||:.:.||:||.|.:..||....:.|.:.|:|::....|:.:|.|.:..|:
Mouse   332 SVDFQRTWKEYKEGFGSPLGEYWLGNEFVSQLTGQHRYVLKIQLKDWEGNEAHSLYDHFYLAGEE 396

  Fly   179 DDYAMNTLGKYSGTAGD-SLRSHRKMKFSTYDRDNDHEFNKNCAFYYLGGWWYNACLDSNLNGQY 242
            .:|.::..| .:||||. |..|.....|||.|.|||....| |:....||||::||..|||||||
Mouse   397 SNYRIHLTG-LTGTAGKISSISQPGSDFSTKDSDNDKCICK-CSQMLSGGWWFDACGPSNLNGQY 459

  Fly   243 MPGGKYEESLFARGMCWRSWRGHNYGYRVTQMMIRP 278
            .| .|...:.| .|:.|..|:|..|..:.|.|||||
Mouse   460 YP-QKQNTNKF-NGIKWYYWKGSGYSLKATTMMIRP 493

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30280NP_611641.6 FReD 65..279 CDD:238040 87/239 (36%)
Angpt2NP_031452.2 RILP-like <168..226 CDD:304877 4/23 (17%)
FBG 280..494 CDD:214548 85/218 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.