DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30280 and angptl3

DIOPT Version :9

Sequence 1:NP_611641.6 Gene:CG30280 / 37522 FlyBaseID:FBgn0050280 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_571893.2 Gene:angptl3 / 114421 ZFINID:ZDB-GENE-010817-3 Length:466 Species:Danio rerio


Alignment Length:230 Identity:84/230 - (36%)
Similarity:128/230 - (55%) Gaps:6/230 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 LETNGTLNTSPDVIYPTSC---LTSGDLENGLHTLKVPGLSPFQVYCENQLAGPGWIVIQKRFSG 113
            |.||.|..|.....:|..|   .|.|...:|::.:|.....||.||||....|.. .|||:|..|
Zfish   235 LTTNSTNGTKDINDFPADCSEVFTRGQKTSGIYPIKPNQSEPFYVYCEITPDGAA-TVIQRREDG 298

  Fly   114 NLSFFRNWKEYKNGFGNLMDEYFLGLEKIRALTALEPHELYVHLEDFDDTIKHAKFDEFAIGNED 178
            ::.|.::|::|::|||.|..|::|||.||.::.....:.|::.|||:.:..:..:: .|.:....
Zfish   299 SVDFDQSWEKYEHGFGKLEKEFWLGLAKIHSIAQQGEYILHIELEDWKEEKRFIEY-TFTLEGPA 362

  Fly   179 DDYAMNTLGKYSGTAGDSLRSHRKMKFSTYDRDNDHEFNKNCAFYYLGGWWYNACLDSNLNGQYM 243
            .|||:: |...||...|::.:|..|||||.|||||:....|||..|.||||::||.|:||||:|.
Zfish   363 SDYALH-LAPLSGDLSDAMSNHTGMKFSTKDRDNDNHDESNCARNYTGGWWFDACGDTNLNGRYA 426

  Fly   244 PGGKYEESLFARGMCWRSWRGHNYGYRVTQMMIRP 278
            ...........:|:.||..:|.:|..:.|::.|||
Zfish   427 WMRSKARHQRRKGIYWRPSKGSSYTLKSTKITIRP 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30280NP_611641.6 FReD 65..279 CDD:238040 79/217 (36%)
angptl3NP_571893.2 SMC_N <111..>209 CDD:330553
FReD 248..461 CDD:238040 77/215 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.