DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30280 and angpt2b

DIOPT Version :9

Sequence 1:NP_611641.6 Gene:CG30280 / 37522 FlyBaseID:FBgn0050280 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_571889.1 Gene:angpt2b / 114408 ZFINID:ZDB-GENE-010817-2 Length:489 Species:Danio rerio


Alignment Length:260 Identity:89/260 - (34%)
Similarity:140/260 - (53%) Gaps:19/260 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 NLEAIYEQAENALSTLQESLLQLETNGTLNTSPD--VIYPTSC---LTSGDLENGLHTLKVP-GL 88
            |...|..|..:...|:|:.|..:.....::|..|  ::....|   ..||..|||::::.:| ..
Zfish   235 NSTLIQRQQASLTDTVQQLLAMVTHCNDISTPVDKEMLKFRDCAEIFKSGVTENGIYSIHLPNST 299

  Fly    89 SPFQVYCENQLAGPGWIVIQKRFSGNLSFFRNWKEYKNGFGNLMDEYFLGLEKIRALTALEPHEL 153
            ...:|:|:.:..|.||.|.|.|:.|::.|.|:|.:||.|||:...|::||.:.|..||..:.:.|
Zfish   300 QKIKVFCDMKTKGGGWTVFQHRYDGSVDFNRDWNDYKLGFGDPSGEHWLGNDVIHLLTTTKDYTL 364

  Fly   154 YVHLEDFDDTIKHAKFDEFAIGNEDDDYAMNTLGKYSGTAG-DSLRSHRKMKFSTYDRDNDHEFN 217
            .|||:|.::...::::|.|.|..||..|:::..| :||||| .|..:|...:|||.|:||| :.:
Zfish   365 QVHLKDAEEHQAYSQYDTFYIDGEDKKYSLHARG-FSGTAGRTSSLTHSGTQFSTKDQDND-QCS 427

  Fly   218 KNCAFYYLGGWWYNACLDSNLNGQYMPGG----KYEESLFARGMCWRSWRGHNYGYRVTQMMIRP 278
            ..||....||||:.||..|||||.|..|.    :|      ..:.|..|:|.::...:|.|||||
Zfish   428 CKCAQMATGGWWFEACGPSNLNGIYYSGNSNVIRY------NSIKWYYWKGPSWMATMTTMMIRP 486

  Fly   279  278
            Zfish   487  486

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30280NP_611641.6 FReD 65..279 CDD:238040 81/223 (36%)
angpt2bNP_571889.1 NYD-SP28 164..244 CDD:291438 3/8 (38%)
FReD 274..487 CDD:238040 81/221 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.