DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30280 and angpt1

DIOPT Version :9

Sequence 1:NP_611641.6 Gene:CG30280 / 37522 FlyBaseID:FBgn0050280 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_571888.1 Gene:angpt1 / 114407 ZFINID:ZDB-GENE-010817-1 Length:513 Species:Danio rerio


Alignment Length:263 Identity:98/263 - (37%)
Similarity:137/263 - (52%) Gaps:21/263 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 GNLEAIYEQAENALSTLQESLLQL---------ETNGTLNTSPDVIYPTSC---LTSGDLENGLH 81
            ||..|:..|.::.:.::: |||.|         |.|.|.....:..: ..|   ..:|..:||::
Zfish   253 GNSTALQRQQQDLMESMR-SLLSLCAKDAATAVEPNSTKQADEERKF-RDCADLYQAGFQKNGVY 315

  Fly    82 TLKVPGLSPFQVYCENQLAGPGWIVIQKRFSGNLSFFRNWKEYKNGFGNLMDEYFLGLEKIRALT 146
            |:.:......:|||..:.||.||.|||||..|.:.|.:.|||||.|||::..|::||.|.:..||
Zfish   316 TINISPQETKKVYCVMESAGGGWTVIQKREDGTVDFQKTWKEYKMGFGSVSGEHWLGNEFVHVLT 380

  Fly   147 ALEPHELYVHLEDFDDTIKHAKFDEFAIGNEDDDYAMNTLGKYSGTAG--DSLRSHRKMKFSTYD 209
            ....|.|.|.|.|:|.....:::|.|.|.:|...|.: .|..:|||||  .||..| ...|||.|
Zfish   381 NQRQHGLRVELSDWDGHQAFSQYDSFHIDSEKQKYRL-FLKTHSGTAGRQSSLAVH-GADFSTKD 443

  Fly   210 RDNDHEFNKNCAFYYLGGWWYNACLDSNLNGQYMPGGKYEESLFARGMCWRSWRGHNYGYRVTQM 274
            .|||:...| ||....|||||:||..|||||.|...|::....  .|:.|..::|.:|..|.|.|
Zfish   444 VDNDNCTCK-CALMLSGGWWYDACGPSNLNGVYYRQGQHVGKF--NGIKWHYFKGPSYSLRSTVM 505

  Fly   275 MIR 277
            |||
Zfish   506 MIR 508

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30280NP_611641.6 FReD 65..279 CDD:238040 87/218 (40%)
angpt1NP_571888.1 RILP-like <206..272 CDD:304877 4/19 (21%)
FReD 298..508 CDD:238040 85/215 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm6515
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.