DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30280 and Fcnb

DIOPT Version :9

Sequence 1:NP_611641.6 Gene:CG30280 / 37522 FlyBaseID:FBgn0050280 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_446086.1 Gene:Fcnb / 114091 RGDID:621222 Length:319 Species:Rattus norvegicus


Alignment Length:215 Identity:92/215 - (42%)
Similarity:124/215 - (57%) Gaps:9/215 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 PTSC---LTSGDLENGLHTLKVPGLSPFQVYCENQLAGPGWIVIQKRFSGNLSFFRNWKEYKNGF 128
            |.:|   ||.|....|.:|:.:|...|..|.|:....|.||.|.|:|..|.:.|||:|..||.||
  Rat   108 PRTCKELLTRGYFLTGWYTIYLPDCRPLTVLCDMDTDGGGWTVFQRRIDGTVDFFRDWTSYKQGF 172

  Fly   129 GNLMDEYFLGLEKIRALTALEPHELYVHLEDFDDTIKHAKFDEFAIGNEDDDYAMNTLGKY-SGT 192
            |:.:.|::||.:.|.|||....:||.|.|.|||.....||:..|.|..|.:.|.: .||.: .|.
  Rat   173 GSQLGEFWLGNDNIHALTTQGTNELRVDLADFDGNHDFAKYSSFQIQGEAEKYKL-ILGNFLGGG 236

  Fly   193 AGDSLRSHRKMKFSTYDRDNDHEFNKNCAFYYLGGWWYNACLDSNLNGQYMPGGKYEESLFARGM 257
            |||||.|...|.|||.|:||| :.:.|||..|.|.|||:.|..|||||.|:.|   ....:|.|:
  Rat   237 AGDSLTSQNNMLFSTKDQDND-QGSSNCAVRYHGAWWYSDCHTSNLNGLYLRG---LHKSYANGV 297

  Fly   258 CWRSWRGHNYGYRVTQMMIR 277
            .|:||:|:||.|:|::|.:|
  Rat   298 NWKSWKGYNYSYKVSEMKVR 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30280NP_611641.6 FReD 65..279 CDD:238040 92/215 (43%)
FcnbNP_446086.1 Collagen 45..100 CDD:189968
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 53..106
FReD 108..317 CDD:238040 91/213 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 186 1.000 Domainoid score I3251
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 187 1.000 Inparanoid score I3822
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 1 1.000 - - mtm12326
orthoMCL 1 0.900 - - OOG6_100073
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.860

Return to query results.
Submit another query.