DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30280 and LOC105947509

DIOPT Version :9

Sequence 1:NP_611641.6 Gene:CG30280 / 37522 FlyBaseID:FBgn0050280 Length:288 Species:Drosophila melanogaster
Sequence 2:XP_031760299.1 Gene:LOC105947509 / 105947509 -ID:- Length:304 Species:Xenopus tropicalis


Alignment Length:214 Identity:88/214 - (41%)
Similarity:125/214 - (58%) Gaps:11/214 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 TSC---LTSGDLENGLHTLKVPGLSPFQVYCENQLAGPGWIVIQKRFSGNLSFFRNWKEYKNGFG 129
            |||   |..|:..:|.:.:...|:||.:|.|:....|.||:|.|:|:.|.:||..:|..||.|||
 Frog    95 TSCKDLLNQGEYLSGWNIITPVGMSPLRVLCDMHTDGGGWLVFQRRWDGTVSFNVDWNTYKRGFG 159

  Fly   130 NLMDEYFLGLEKIRALTALEPHELYVHLEDFDDTIKHAKFDEFAIGNEDDDYAMNTLGKYS-GTA 193
            :.|:|::||.:.:..||:....||.:.|.|||:.:.:||:..|.|..||::|.: .||.|: |..
 Frog   160 SEMNEFWLGNDILYNLTSSGTWELRIDLRDFDNNMYYAKYSFFQILGEDNNYTL-LLGSYNEGNI 223

  Fly   194 GDSLRSHRKMKFSTYDRDNDHEFNKNCAFYYLGGWWYNACLDSNLNGQYMPGGKYEESLFARGMC 258
            ||||..|..:.||||||||:. ..:||||...||||||.|..|||||.|......|     .|:.
 Frog   224 GDSLTPHNTVPFSTYDRDNNF-LLENCAFDNQGGWWYNNCYQSNLNGLYRLVQNNE-----TGIN 282

  Fly   259 WRSWRGHNYGYRVTQMMIR 277
            |.|...::|.|:.::|.||
 Frog   283 WLSDGRNHYSYKSSEMKIR 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30280NP_611641.6 FReD 65..279 CDD:238040 88/214 (41%)
LOC105947509XP_031760299.1 Collagen <65..88 CDD:396114
FReD 93..303 CDD:238040 88/214 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 171 1.000 Inparanoid score I3986
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.