DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30280 and ANGPTL7

DIOPT Version :9

Sequence 1:NP_611641.6 Gene:CG30280 / 37522 FlyBaseID:FBgn0050280 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_066969.1 Gene:ANGPTL7 / 10218 HGNCID:24078 Length:346 Species:Homo sapiens


Alignment Length:255 Identity:95/255 - (37%)
Similarity:147/255 - (57%) Gaps:18/255 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 EAIYEQAENALSTLQESLLQLETNGTLNTSPDVIYPTSCLTSGDLE-NGLHTLKVP-----GLSP 90
            |:.|.:..|.:..:|....|..|    .||.|.||..|.|...:.. :|::  |:|     |...
Human    99 ESKYSEMNNQIDIMQLQAAQTVT----QTSADAIYDCSSLYQKNYRISGVY--KLPPDDFLGSPE 157

  Fly    91 FQVYCENQLAGPGWIVIQKRFSGNLSFFRNWKEYKNGFGNLMDEYFLGLEKIRALTALEPHELYV 155
            .:|:|:.:.:|.||.:||:|.||.:||:|:||:||.|||::..:::||.|.|..|:. :|..|.|
Human   158 LEVFCDMETSGGGWTIIQRRKSGLVSFYRDWKQYKQGFGSIRGDFWLGNEHIHRLSR-QPTRLRV 221

  Fly   156 HLEDFDDTIKHAKFDEFAIGNEDDDYAMNTLGKYSGTAG-DSLRSHRKMKFSTYDRDNDHEFNKN 219
            .:||::..:::|::..|.:|||.:.|.: .||.|:|..| |:|:.|....|||.|:|||:..:| 
Human   222 EMEDWEGNLRYAEYSHFVLGNELNSYRL-FLGNYTGNVGNDALQYHNNTAFSTKDKDNDNCLDK- 284

  Fly   220 CAFYYLGGWWYNACLDSNLNGQYMPGGKYEESLFARGMCWRSWRGHNYGYRVTQMMIRPK 279
            ||....||:|||.|.||||||.|...|::.:.|  .|:.|..|.|..|..:..:|.|||:
Human   285 CAQLRKGGYWYNCCTDSNLNGVYYRLGEHNKHL--DGITWYGWHGSTYSLKRVEMKIRPE 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30280NP_611641.6 FReD 65..279 CDD:238040 85/220 (39%)
ANGPTL7NP_066969.1 SMC_N <37..>109 CDD:330553 3/9 (33%)
FReD 129..341 CDD:238040 83/218 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm41874
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3359
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.