DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30280 and angpt2a

DIOPT Version :9

Sequence 1:NP_611641.6 Gene:CG30280 / 37522 FlyBaseID:FBgn0050280 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_001265754.1 Gene:angpt2a / 101101687 ZFINID:ZDB-GENE-121101-1 Length:488 Species:Danio rerio


Alignment Length:253 Identity:86/253 - (33%)
Similarity:132/253 - (52%) Gaps:14/253 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 EQAENALSTLQESLLQL-------ETNGTLNTSPDVIYPTSCL-TSGDLENGLHTLKVPGL-SPF 91
            :|.:..|:....:|:|.       ..:..:..:||.:...:.: ..|:.::|:::|.:||. ..|
Zfish   237 KQQQQELTNTVNNLIQTISVTRQGSNSAMMQDNPDQLIDCAVVFKQGNKKSGVYSLTIPGTKQQF 301

  Fly    92 QVYCENQLAGPGWIVIQKRFSGNLSFFRNWKEYKNGFGNLMDEYFLGLEKIRALTALEPHELYVH 156
            :.||:....|.||.||||||:|.:.|.:.||.|..|||::..|::||.|.|..||..:.|.|.:.
Zfish   302 KAYCDMGTDGGGWTVIQKRFNGLVDFHQTWKNYTMGFGDISGEHWLGNEIISKLTQEKQHTLRID 366

  Fly   157 LEDFDDTIKHAKFDEFAIGNEDDDYAMNTLGKYSGTAG-DSLRSHRKMKFSTYDRDNDHEFNKNC 220
            |.|::.....:|:.:|::..|..:|.: :|..|||||| .|........||..|.|||....| |
Zfish   367 LMDWEGNTAFSKYSQFSLDGEKQNYRI-SLNGYSGTAGRTSSMGQTGGDFSAKDLDNDKCVCK-C 429

  Fly   221 AFYYLGGWWYNACLDSNLNGQYMPGGKYEESLFARGMCWRSWRGHNYGYRVTQMMIRP 278
            :....||||::||..|||||.|...|:.....  .|:.|..|:|..|..:.|.|||||
Zfish   430 SQMLSGGWWFDACGPSNLNGIYYQQGQNTNRF--NGIKWYYWKGSAYSLKATTMMIRP 485

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30280NP_611641.6 FReD 65..279 CDD:238040 80/217 (37%)
angpt2aNP_001265754.1 FReD 275..485 CDD:238040 78/213 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.