DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30280 and mfap4.11

DIOPT Version :9

Sequence 1:NP_611641.6 Gene:CG30280 / 37522 FlyBaseID:FBgn0050280 Length:288 Species:Drosophila melanogaster
Sequence 2:XP_003197842.1 Gene:mfap4.11 / 100538113 ZFINID:ZDB-GENE-121214-183 Length:244 Species:Danio rerio


Alignment Length:222 Identity:81/222 - (36%)
Similarity:119/222 - (53%) Gaps:13/222 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 PTSC---LTSGDLENGLHTLKVPGLSPFQVYCENQLAGP-----GWIVIQKRFSGNLSFFRNWKE 123
            |..|   ..||...:|::::...|.:|..|||:....|.     ||.|.|:|..|.::|::.|:.
Zfish    24 PFDCSEIYKSGQTVSGVYSIYPAGDTPVWVYCQMISDGKDEENGGWTVFQRRMDGRINFYQPWEV 88

  Fly   124 YKNGFGNLMDEYFLGLEKIRALTALEPHELYVHLEDFDDTIKHAKFDEFAIGNEDDDYAMNTLGK 188
            ||.|||....||:||||.:..||..:...|.|.||||:.....|::..|::|:|.:.|.:...|.
Zfish    89 YKRGFGTTEGEYWLGLENLYQLTRHKKFMLRVDLEDFEGRKVFAQYSSFSVGSEAEGYKLQVSGF 153

  Fly   189 YSGTAGDSLRSHRKMKFSTYDRDNDHEFNKNCAFYYLGGWWYN-ACLDSNLNGQYMPGGKYEESL 252
            ..|.|||||.:|...||||.|:|.| .:.||||.|:|||:||. .|..:|.||.|:.|  ...:.
Zfish   154 TDGGAGDSLSAHNDRKFSTLDKDQD-LYEKNCARYFLGGFWYTVGCHYTNPNGMYLWG--EHNTR 215

  Fly   253 FARGMCWRSWR-GHNYGYRVTQMMIRP 278
            :|.|:.|.:|: ......:...|.|:|
Zfish   216 YAIGVVWSTWKNSFTLSMKTFLMKIKP 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30280NP_611641.6 FReD 65..279 CDD:238040 81/222 (36%)
mfap4.11XP_003197842.1 FReD 24..243 CDD:238040 81/222 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 190 1.000 Domainoid score I3199
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 1 1.000 - - mtm6355
orthoMCL 1 0.900 - - OOG6_100073
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.910

Return to query results.
Submit another query.