DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30280 and LOC100496945

DIOPT Version :9

Sequence 1:NP_611641.6 Gene:CG30280 / 37522 FlyBaseID:FBgn0050280 Length:288 Species:Drosophila melanogaster
Sequence 2:XP_002935082.1 Gene:LOC100496945 / 100496945 -ID:- Length:306 Species:Xenopus tropicalis


Alignment Length:224 Identity:92/224 - (41%)
Similarity:130/224 - (58%) Gaps:12/224 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 SPDVIYPT-SC---LTSGDLENGLHTLKVPGLSPFQVYCENQLAGPGWIVIQKRFSGNLSFFRNW 121
            :||.:|.. :|   |..|.:.:|.:.:...|..|..|.|:....|.||||.|:.:.|::.|||:|
 Frog    90 APDQLYAARNCKELLDQGAILSGWYKIYPDGERPLTVLCDMDTDGGGWIVFQRTWDGSVDFFRDW 154

  Fly   122 KEYKNGFGNLMDEYFLGLEKIRALTALEPHELYVHLEDFDDTIKHAKFDEFAIGNEDDDYAMNTL 186
            ..||.|||:.:.|::||.:.|..||:...::|.:...||::....|.:|.||...|.|.|.: .|
 Frog   155 DSYKKGFGSQLSEFWLGNDNIHTLTSSGTYQLRIDFTDFENQNSFAAYDSFATLGEKDHYQL-IL 218

  Fly   187 GKYS-GTAGDSLRSHRKMKFSTYDRDNDHEFNKNCAFYYLGGWWYNACLDSNLNGQYMPGGKYEE 250
            |.|| |||||||..||...|||  :|||...| |||..:.|||||.:|.|:||||.|:.|....:
 Frog   219 GAYSGGTAGDSLNHHRNCPFST--KDNDLHGN-NCAETFKGGWWYGSCHDANLNGLYLRGKHSND 280

  Fly   251 SLFARGMCWRSWRGHNYGYRVTQMMIRPK 279
            .|   |:.|.:.:|:||.|:||:|..|||
 Frog   281 GL---GINWETGKGNNYSYKVTEMKFRPK 306

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG30280NP_611641.6 FReD 65..279 CDD:238040 88/218 (40%)