DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30280 and LOC100496379

DIOPT Version :9

Sequence 1:NP_611641.6 Gene:CG30280 / 37522 FlyBaseID:FBgn0050280 Length:288 Species:Drosophila melanogaster
Sequence 2:XP_031746585.1 Gene:LOC100496379 / 100496379 -ID:- Length:490 Species:Xenopus tropicalis


Alignment Length:221 Identity:86/221 - (38%)
Similarity:126/221 - (57%) Gaps:10/221 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 VIYPT--SCL---TSGDLENGLHTLKVPGLSPFQVYCENQLAGPGWIVIQKRFSGNLSFFRNWKE 123
            |.||.  :|:   |.|.|.:|.:|:...|..|..|.|:....|.||||.|||..|::.|:|:|..
 Frog   273 VWYPAVKNCMELRTYGVLFSGWYTIYPDGNKPLNVLCDMHTDGGGWIVFQKRMDGSVDFYRDWGS 337

  Fly   124 YKNGFGNLMDEYFLGLEKIRALTALEPHELYVHLEDFDDTIKHAKFDEFAIGNEDDDYAMNTLGK 188
            |:.|||:.:.|::||.|.|..||:....:|.:.|||||:...:|.:.:|.:..|...|.:. ||.
 Frog   338 YRQGFGSQLSEFWLGNENIHRLTSSGNIQLRIDLEDFDNNRTYATYSQFRLEPESQKYTLR-LGA 401

  Fly   189 YS-GTAGDSLRSHRKMKFSTYDRDNDHEFNKNCAFYYLGGWWYNACLDSNLNGQYMPGGKYEESL 252
            :: |||||||.||....|::.|.|.|...|.|||..|.|.|||..|.|:.|||:|:.|...:.  
 Frog   402 FTGGTAGDSLSSHNNKAFASKDADYDESVNSNCAEKYKGAWWYVKCYDACLNGEYLRGPLGQN-- 464

  Fly   253 FARGMCWRSWRGHNYGYRVTQMMIRP 278
             ..|:.|:::||:||..:.::|..||
 Frog   465 -YGGIAWKTFRGYNYSLKKSEMKFRP 489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30280NP_611641.6 FReD 65..279 CDD:238040 85/220 (39%)
LOC100496379XP_031746585.1 Collagen 91..144 CDD:396114
Collagen <213..270 CDD:396114
FReD 276..490 CDD:238040 84/218 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 182 1.000 Domainoid score I3392
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 171 1.000 Inparanoid score I3986
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 1 1.000 - - mtm14088
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.050

Return to query results.
Submit another query.