DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30280 and LOC100495637

DIOPT Version :9

Sequence 1:NP_611641.6 Gene:CG30280 / 37522 FlyBaseID:FBgn0050280 Length:288 Species:Drosophila melanogaster
Sequence 2:XP_004917595.2 Gene:LOC100495637 / 100495637 -ID:- Length:289 Species:Xenopus tropicalis


Alignment Length:209 Identity:79/209 - (37%)
Similarity:116/209 - (55%) Gaps:3/209 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 LTSGDLENGLHTLKVPGLSPFQVYCENQLAGPGWIVIQKRFSGNLSFFRNWKEYKNGFGNLMDEY 135
            |..|....|.:.:..|......|:|:.:..|.||.|.|:|..|::.|:|:|..||.|||....|:
 Frog    83 LDQGSSITGWYPIYTPTGRRLLVFCDMETDGGGWTVFQRRADGSVDFYRDWNSYKRGFGRKESEF 147

  Fly   136 FLGLEKIRALTALEPHELYVHLEDFDDTIKHAKFDEFAIGNEDDDYAMNTLGKYSGTAGDSLRSH 200
            :||.:.:..|||....:|.|.|.||.:...:|.:..|.|..|..:|.::..|...|.|||||..|
 Frog   148 WLGNDNLHLLTATGNFQLRVDLTDFSEQRTYAAYSNFRIAGEAQNYTLSLGGFTGGDAGDSLSGH 212

  Fly   201 RKMKFSTYDRDNDHEFNKNCAFYYLGGWWYNACLDSNLNGQYMPGGKYEESLFARGMCWRSWRGH 265
            ....||:.|||||.....:||..|.|||||:.|..|||||.|: ||.:  :.:|.|:.|.:.:|:
 Frog   213 NGYSFSSKDRDNDVHLTGSCAQSYKGGWWYSKCHGSNLNGLYL-GGNH--TSYANGVNWSAGKGY 274

  Fly   266 NYGYRVTQMMIRPK 279
            :|.|:|::|..||:
 Frog   275 HYSYKVSEMKFRPQ 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30280NP_611641.6 FReD 65..279 CDD:238040 78/207 (38%)
LOC100495637XP_004917595.2 Collagen 40..>75 CDD:396114
FReD 77..287 CDD:238040 77/206 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D242508at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.