DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30280 and angptl4

DIOPT Version :9

Sequence 1:NP_611641.6 Gene:CG30280 / 37522 FlyBaseID:FBgn0050280 Length:288 Species:Drosophila melanogaster
Sequence 2:XP_002938598.2 Gene:angptl4 / 100492339 XenbaseID:XB-GENE-481750 Length:457 Species:Xenopus tropicalis


Alignment Length:262 Identity:83/262 - (31%)
Similarity:149/262 - (56%) Gaps:25/262 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 QAENALSTLQESLLQLET-----------NGTLNTSPDV---IYPTSC---LTSGDLENGLHTLK 84
            |.::..:|:|.:.|:.:|           ....|:|.:.   ::|:.|   ...|...:|:.:::
 Frog   194 QIKSLQNTIQSNRLETQTWKMNLKKTVEDEAQSNSSTEEGKHVFPSDCHQIFLEGKKSSGIFSIQ 258

  Fly    85 VPGLSPFQVYCENQLAGPGWIVIQKRFSGNLSFFRNWKEYKNGFGNLMDEYFLGLEKIRALTALE 149
            ..|..||:|||| ..|..||.|.|:|..|::.|.|.|..|.:|||||..|::|||||:..:|...
 Frog   259 PSGAQPFEVYCE-MTADAGWTVTQRRTDGSVDFDRLWDAYTDGFGNLNGEFWLGLEKMHQITQQG 322

  Fly   150 PHELYVHLEDFDDTIKHAKFDEFAIGNEDDDYAMNTLGKYSGTAGDSLRSHRKMKFSTYDRDNDH 214
            .:.:::.|:|:::.::|.: .:|.:...::.||:..||..:|...::|...::::|||.|||.|.
 Frog   323 QYLIHIDLQDWENNVQHME-AKFLLAGSNEAYALQLLGPVTGELENALSDFQQLQFSTRDRDQDK 386

  Fly   215 EFNKNCAFYYLGGWWYNACLDSNLNGQY---MPGGKYEESLFARGMCWRSWRGHNYGYRVTQMMI 276
            :.:.|||.:..||||:::|..|||||:|   :|..::|..   :|:.|::|:|..|..:.|.:.|
 Frog   387 KSDFNCAKHLSGGWWFSSCGHSNLNGKYFLSVPRARHERK---QGIFWKTWKGRYYPLKSTSIKI 448

  Fly   277 RP 278
            ||
 Frog   449 RP 450

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30280NP_611641.6 FReD 65..279 CDD:238040 76/220 (35%)
angptl4XP_002938598.2 Smc <55..>234 CDD:224117 7/39 (18%)
FReD 237..451 CDD:238040 76/219 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm48348
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.