DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30280 and XB5913531

DIOPT Version :9

Sequence 1:NP_611641.6 Gene:CG30280 / 37522 FlyBaseID:FBgn0050280 Length:288 Species:Drosophila melanogaster
Sequence 2:XP_012826224.3 Gene:XB5913531 / 100488177 XenbaseID:XB-GENE-5913532 Length:255 Species:Xenopus tropicalis


Alignment Length:250 Identity:88/250 - (35%)
Similarity:125/250 - (50%) Gaps:22/250 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 LSTLQESLLQLETNGTLNTSPDVIYPTSCLTSGDL------ENGLHTLKVPG-LSPFQVYCENQL 99
            ||.:...:.|.|:..||     |::....|...||      .:|.:.:...| ..|..|||:...
 Frog    12 LSLISPIISQSESLDTL-----VLHKIPPLDCQDLWDKGFRSDGEYLIYPQGPQHPLPVYCDMTT 71

  Fly   100 AGPGWIVIQKRFSGNLSFFRNWKEYKNGFGNLMDEYFLGLEKIRALTALEPHELYVHLEDFDDTI 164
            .|..|.|.||||.|:..|.:||::|..||||...||:|||:.|:.||....:||.|.||:|:...
 Frog    72 NGMPWTVFQKRFDGSTDFNQNWQDYVMGFGNADYEYWLGLQNIQRLTMTGRYELRVELENFNGQK 136

  Fly   165 KHAKFDEF-----AIGNEDDDYAMNTLGKYSGTAGDSLRSHRKMKFSTYDRDNDHEFNKNCAFYY 224
            .:|.:..|     |:..|.|.|.:...|...|.|||||..|...:|||||.|..::. :|||.|:
 Frog   137 VYAFYSNFSLSPQALNAEHDGYKLYVDGFTDGGAGDSLSVHVGQRFSTYDNDQINDI-QNCAEYW 200

  Fly   225 LGGWWY--NACLDSNLNGQYMPGGKYEESLFARGMCWRSWRGHNYGYRVTQMMIR 277
            .||:||  |.|.|:.||.:|:.....:..  ..|..|.:|..:....|.:|||:|
 Frog   201 GGGFWYYSNGCADAGLNARYINPNTLKSP--QHGFSWVTWVEYPETLRASQMMMR 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30280NP_611641.6 FReD 65..279 CDD:238040 80/226 (35%)
XB5913531XP_012826224.3 FReD 33..255 CDD:238040 80/223 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.