DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30280 and fibcd1a

DIOPT Version :9

Sequence 1:NP_611641.6 Gene:CG30280 / 37522 FlyBaseID:FBgn0050280 Length:288 Species:Drosophila melanogaster
Sequence 2:XP_005166963.1 Gene:fibcd1a / 100151577 ZFINID:ZDB-GENE-081105-148 Length:464 Species:Danio rerio


Alignment Length:279 Identity:103/279 - (36%)
Similarity:156/279 - (55%) Gaps:42/279 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 NLEAIYEQAENALSTLQESLLQLETNGTLNT--SPDV-------IYPTSC--------------L 71
            |:..:.....:|||::|:.      ||.:.:  ..|:       :.|..|              .
Zfish   192 NMVKVVNSVSDALSSMQKE------NGNIKSRLKADLQRAPVRSVRPKGCAAGEGSRPRDCSDIY 250

  Fly    72 TSGDLENGLHTLKVPGLSP--FQVYCENQLAGPGWIVIQKRFSGNLSFFRNWKEYKNGFGNLMDE 134
            .||..|:|:::: .|...|  |||:|:....|.||.|||:|..|:::|||:|:.|:.|||.:..|
Zfish   251 ASGQREDGIYSV-FPTHYPAGFQVFCDMTTDGGGWTVIQRREDGSVNFFRDWEAYREGFGKITGE 314

  Fly   135 YFLGLEKIRALTALEPHELYVHLEDFDDTIKHAKFDEFAIG-----NEDDDYAMNTLGKYSGTAG 194
            ::||:::|.|||....:||.:.||||:::...|::..|.:|     .::|.|.: ::..||||||
Zfish   315 HWLGMKRIHALTIQANYELRIDLEDFENSTSFAQYGSFGVGLFSVDPDEDGYPL-SIADYSGTAG 378

  Fly   195 DSLRSHRKMKFSTYDRDNDHEFNKNCAFYYLGGWWYNACLDSNLNGQYMPGGKYEESLFARGMCW 259
            |||..|..|||:|.|:||||..| |||.:|.|.|||..|..|||||||:.|   :.:.:|.|:.|
Zfish   379 DSLLKHNGMKFTTKDKDNDHSEN-NCASFYHGAWWYRNCHTSNLNGQYLRG---QHTSYADGIEW 439

  Fly   260 RSWRGHNYGYRVTQMMIRP 278
            .||.|..|..:.|:|.|||
Zfish   440 SSWTGWQYSLKFTEMKIRP 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30280NP_611641.6 FReD 65..279 CDD:238040 95/235 (40%)
fibcd1aXP_005166963.1 FReD 243..458 CDD:238040 91/220 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 190 1.000 Domainoid score I3199
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H122246
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D242508at33208
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.