DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30280 and angptl7

DIOPT Version :9

Sequence 1:NP_611641.6 Gene:CG30280 / 37522 FlyBaseID:FBgn0050280 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_001096248.1 Gene:angptl7 / 100124808 XenbaseID:XB-GENE-6046184 Length:343 Species:Xenopus tropicalis


Alignment Length:266 Identity:103/266 - (38%)
Similarity:150/266 - (56%) Gaps:24/266 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 LEAIYEQAENALSTL---------QESLLQLETNGTL-NTSPDVIYPTSCLTSGDLE-NGLHTLK 84
            ||..|:|.|..::.:         |..::||:...|| .||.|.:|..|.|...:.: :|::  |
 Frog    81 LEGSYKQMETRVTDVEGKYSEMNNQMDIMQLQAAQTLTQTSADAVYDCSSLFQKNYKISGVY--K 143

  Fly    85 VP-----GLSPFQVYCENQLAGPGWIVIQKRFSGNLSFFRNWKEYKNGFGNLMDEYFLGLEKIRA 144
            :|     |....:|:|:.:..|.||.:||:|..|..||.|.||:|:.||||:..:::||.|.|..
 Frog   144 LPADDFLGSPELEVFCDMETQGGGWTLIQRRKIGLTSFNREWKQYREGFGNIRGDFWLGNEHIYR 208

  Fly   145 LTALEPHELYVHLEDFDDTIKHAKFDEFAIGNEDDDYAMNTLGKYSGTAG-DSLRSHRKMKFSTY 208
            ||. .|..|.|.|||::..::||::.:|:|.||.:.|.: .||.|||.|| ||||.|....|||.
 Frog   209 LTR-RPTVLRVELEDWEGGVRHAEYSQFSISNEQNSYRL-ILGNYSGNAGRDSLRYHNNTAFSTK 271

  Fly   209 DRDNDHEFNKNCAFYYLGGWWYNACLDSNLNGQYMPGGKYEESLFARGMCWRSWRGHNYGYRVTQ 273
            |:|||...: :||....||:|||.|.||||||.|...|  |.:..:.|:.|..|.|.:|..:..:
 Frog   272 DKDNDKCLD-DCAGLRKGGYWYNCCTDSNLNGIYYRNG--EHNKHSDGISWYGWHGTSYSLKRVE 333

  Fly   274 MMIRPK 279
            |.|||:
 Frog   334 MKIRPQ 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30280NP_611641.6 FReD 65..279 CDD:238040 89/220 (40%)
angptl7NP_001096248.1 FReD 126..338 CDD:238040 88/218 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 171 1.000 Inparanoid score I3986
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm48348
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3359
SonicParanoid 1 1.000 - - X25
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.