DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30280 and angptl2

DIOPT Version :9

Sequence 1:NP_611641.6 Gene:CG30280 / 37522 FlyBaseID:FBgn0050280 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_001090872.1 Gene:angptl2 / 100038298 XenbaseID:XB-GENE-488164 Length:493 Species:Xenopus tropicalis


Alignment Length:251 Identity:99/251 - (39%)
Similarity:141/251 - (56%) Gaps:15/251 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 QAENALSTLQESL--LQLETNGTLNTSPDVIYP-TSCLTSGDLENGLHTLKVPGLSP------FQ 92
            |.:..|..|...|  :.|.|:.: ||:.....| ..||.:  ||:|..|..:..:.|      .|
 Frog   243 QGDQNLKVLPPPLPTMPLFTSNS-NTTDKPSGPWKDCLQA--LEDGHDTSSIYLVKPENTNRLMQ 304

  Fly    93 VYCENQLAGPGWIVIQKRFSGNLSFFRNWKEYKNGFGNLMDEYFLGLEKIRALTALEPHELYVHL 157
            |:|:.:....||.|||:|..|:::|.|||:.||:||||:..||:||||.|..||..:.::|.|.:
 Frog   305 VWCDQRHDPGGWTVIQRRLDGSVNFLRNWETYKHGFGNIDGEYWLGLENIYWLTNKDNYKLLVTM 369

  Fly   158 EDFDDTIKHAKFDEFAIGNEDDDYAMNTLGKYSGTAGDSLRSHRKMKFSTYDRDNDHEFNKNCAF 222
            ||:......|::..|.:..|.:.|.:. ||:|.|.||||...|...:|:|.|||:| .::.|||.
 Frog   370 EDWSGRKVFAEYASFRLEPESEYYKLR-LGRYHGNAGDSFTWHNGKQFTTLDRDHD-VYSGNCAH 432

  Fly   223 YYLGGWWYNACLDSNLNGQYMPGGKYEESLFARGMCWRSWRGHNYGYRVTQMMIRP 278
            |..||||||||..|||||.:..||.| .|.:..|:.|..:||.:|..:...|||||
 Frog   433 YQKGGWWYNACAHSNLNGVWYRGGHY-RSRYQDGVYWAEFRGGSYSLKKVVMMIRP 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30280NP_611641.6 FReD 65..279 CDD:238040 91/221 (41%)
angptl2NP_001090872.1 RILP-like 86..196 CDD:304877
FReD 273..487 CDD:238040 89/218 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm48348
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.