DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30280 and fga

DIOPT Version :9

Sequence 1:NP_611641.6 Gene:CG30280 / 37522 FlyBaseID:FBgn0050280 Length:288 Species:Drosophila melanogaster
Sequence 2:XP_002933535.3 Gene:fga / 100038060 XenbaseID:XB-GENE-478771 Length:761 Species:Xenopus tropicalis


Alignment Length:226 Identity:81/226 - (35%)
Similarity:126/226 - (55%) Gaps:24/226 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 SGDLENGLHTLKVPGLSP-FQVYCENQLAGPGWIVIQKRFSGNLSFFRNWKEYKNGFGNL----M 132
            |...::|:..::..|.:. ..|||:......|||:||:|..|:::|.|.|::||||||::    .
 Frog   535 SSGAKSGIFKIRPEGSTKVLSVYCDQDTQLGGWILIQQRQDGSVNFNRTWQDYKNGFGSVDAGGK 599

  Fly   133 DEYFLGLEKIRALTALEPHELYVHLEDFDDTIKHAKFDEFAIGNEDDDYAMNTLGKYSGTAGDSL 197
            .|.:||.|.|..||..:. .|.:.|||:.....:|::: ..:|:|.:.:.:. :.:|.|||||:|
 Frog   600 GEVWLGNENIHLLTQKDT-ILRIELEDWSGEKVYAEYN-IQLGSEAEGFTLK-VSQYEGTAGDAL 661

  Fly   198 ----------RSHRKMKFSTYDRDNDHEFNKNCAFYYLGGWWYNACLDSNLNGQYMPGGKYEES- 251
                      .||..|||||||||:| ::.:|||..|.||||||.|..|||||.|..||:|:.. 
 Frog   662 IEGSKEDGEYTSHINMKFSTYDRDSD-KWEENCAEMYGGGWWYNNCQASNLNGIYYIGGQYDPRN 725

  Fly   252 ----LFARGMCWRSWRGHNYGYRVTQMMIRP 278
                ....|:.|..::..:|..:..:|.:||
 Frog   726 NFPYEIENGVVWVPFKAADYSLKTVRMKMRP 756

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30280NP_611641.6 FReD 65..279 CDD:238040 81/226 (36%)
fgaXP_002933535.3 Fib_alpha 51..191 CDD:400857
Fibrinogen_aC 299..372 CDD:403400
FReD 523..757 CDD:238040 81/226 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.