DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30280 and LOC100007488

DIOPT Version :9

Sequence 1:NP_611641.6 Gene:CG30280 / 37522 FlyBaseID:FBgn0050280 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_001315007.1 Gene:LOC100007488 / 100007488 -ID:- Length:245 Species:Danio rerio


Alignment Length:226 Identity:85/226 - (37%)
Similarity:127/226 - (56%) Gaps:13/226 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 SPDVIYPTSC---LTSGDLENGLHTLKVPGLSPFQVYCENQLAGP-----GWIVIQKRFSGNLSF 117
            |..|..|..|   ..||...:|::::...|..|..|||:....|.     ||.|||:|..|:::|
Zfish    21 SHSVDKPFDCSDIYKSGQNLSGIYSIYPAGDFPVWVYCQMVSEGKDEDKGGWTVIQRRMDGSVNF 85

  Fly   118 FRNWKEYKNGFGNLMDEYFLGLEKIRALTALEPHELYVHLEDFDDTIKHAKFDEFAIGNEDDDYA 182
            :|.|::||.|||.:..||:||||.:..||..:...|.|.||||:.....|::..|::|.|.:.|.
Zfish    86 YRPWRDYKRGFGKVEGEYWLGLENLYQLTRHKKFMLRVDLEDFEGRRGFAQYSSFSVGCECEGYK 150

  Fly   183 MNTLGKYSGTAGDSLRSHRKMKFSTYDRDND-HEFNKNCAFYYLGGWWYNACLDSNLNGQYMPGG 246
            :...|...|.|||.|..|..:||||:|:|.| ||  |:||..||||:||.:|.::|.||.|:.| 
Zfish   151 LQVSGFTDGGAGDCLSGHNDLKFSTFDKDQDTHE--KSCAKEYLGGFWYGSCHNTNPNGVYLWG- 212

  Fly   247 KYEESLFARGMCWRSWRGHNYGYRVTQMMIR 277
             .:.:.:|.|:||.:|:.:....:...|.|:
Zfish   213 -EDPTHYAIGVCWSTWKNYAVSMKTFSMKIK 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30280NP_611641.6 FReD 65..279 CDD:238040 83/222 (37%)
LOC100007488NP_001315007.1 FReD 25..244 CDD:238040 83/222 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 190 1.000 Domainoid score I3199
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100073
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.910

Return to query results.
Submit another query.