DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30280 and mfap4.12

DIOPT Version :9

Sequence 1:NP_611641.6 Gene:CG30280 / 37522 FlyBaseID:FBgn0050280 Length:288 Species:Drosophila melanogaster
Sequence 2:XP_001339837.3 Gene:mfap4.12 / 100007462 ZFINID:ZDB-GENE-110408-35 Length:247 Species:Danio rerio


Alignment Length:232 Identity:92/232 - (39%)
Similarity:134/232 - (57%) Gaps:14/232 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 SPDVIYPTSCL---TSGDLENGLHTLKVPGLSPFQVYCENQLAGP-----GWIVIQKRFSGNLSF 117
            |.|...|..|.   .:|:..:|::|:...|.:|..|||:....|.     ||.|||:|..|:::|
Zfish    22 SEDEDSPVDCSELNKAGETLSGVYTIHPAGDAPVWVYCQMVSDGKDEENGGWTVIQRRMDGSVNF 86

  Fly   118 FRNWKEYKNGFGNLMDEYFLGLEKIRALTALEPHELYVHLEDFDDTIKHAKFDEFAIGNEDDDYA 182
            :|.|::||.|||||..||:||||.:..||..:.|.|.|.||||:.....|::..|::|.|.|.|.
Zfish    87 YRPWRDYKRGFGNLEGEYWLGLENLYQLTRHKDHMLRVDLEDFEGRKGFAQYSSFSVGCETDGYQ 151

  Fly   183 MNTLGKYSGTAGDSLRSHRKMKFSTYDRDNDHEFNKNCAFYYLGGWWYNACLDSNLNGQYMPGGK 247
            :...|...|.||||:..|..|||||:|:|.|: |:|:||..|||.:||:.|..:|.||.|:.|  
Zfish   152 LQVSGFTDGGAGDSMTYHNGMKFSTFDKDQDN-FDKSCARLYLGAFWYDNCHHANPNGVYLWG-- 213

  Fly   248 YEESLFARGMCWRSWRGHNYGYRVTQMMIRPKCRMIP 284
            .:.::||.|..|..|: :|||  :....|..|.:.:|
Zfish   214 EDATIFAIGNVWYGWK-NNYG--IGMKSITMKIKHVP 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30280NP_611641.6 FReD 65..279 CDD:238040 88/221 (40%)
mfap4.12XP_001339837.3 FReD 26..244 CDD:238040 89/223 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100073
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.