DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30280 and fgl2b

DIOPT Version :9

Sequence 1:NP_611641.6 Gene:CG30280 / 37522 FlyBaseID:FBgn0050280 Length:288 Species:Drosophila melanogaster
Sequence 2:XP_001341185.5 Gene:fgl2b / 100001116 ZFINID:ZDB-GENE-120709-53 Length:1447 Species:Danio rerio


Alignment Length:275 Identity:95/275 - (34%)
Similarity:143/275 - (52%) Gaps:40/275 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 EQAENALSTLQESLLQLETNGTLNTSPDVIYPTSCLT---------------SGDLENGLHTLKV 85
            |:|||.:.:  ..|....|..|.::.|......:.|.               :....||::.:..
Zfish  1176 EKAENKIHS--TCLGNCNTTSTPHSQPSTSQTRTPLAPEREKRPAQDCADYITKSRRNGVYRVTP 1238

  Fly    86 -PGLSPFQVYCENQLAGPGWIVIQKRFSGNLSFFRNWKEYKNGFGNLMDEYFLGLEKIRALTALE 149
             |..:.|.|:|:...:|.||.:||.||.|:.||.|.|.|||||||.|:.|::||.:||..||..:
Zfish  1239 RPKNTTFPVFCDMASSGGGWTLIQHRFDGSTSFNRTWDEYKNGFGKLIGEFWLGNDKIHLLTKAK 1303

  Fly   150 PHELYVHLEDFDDTIKHAKFDEFAIGNEDDDYAMNTLGKYSGTAGDSLR-----SHRKMKFSTYD 209
            ...|.:.:|||:...::|::|.|.|.||...|.::..| ||||||::::     :|.:..|:|.|
Zfish  1304 NMSLRIEIEDFEGIREYAQYDHFYIANESQQYRLSIDG-YSGTAGNAMQFSKKYNHDQKFFTTPD 1367

  Fly   210 RDNDHEFNKNCAFYYLGGWWYNACLDSNLNGQYMPGGKYEESLFARGMCWRSWRGHN-------- 266
            ||||...:.||..||..|||::||:.:||||:|.. .||:.  ...|:.|.:|  ||        
Zfish  1368 RDNDQYPSGNCGAYYSSGWWFDACMSANLNGKYYQ-SKYKG--VRNGIFWGTW--HNITMEYYPT 1427

  Fly   267 ---YGYRVTQMMIRP 278
               ..:|..:|||||
Zfish  1428 NERQSFRTVRMMIRP 1442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30280NP_611641.6 FReD 65..279 CDD:238040 87/246 (35%)
fgl2bXP_001341185.5 FReD 1219..1442 CDD:238040 84/228 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.