DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Plekhm1 and DEF8

DIOPT Version :9

Sequence 1:NP_611639.1 Gene:Plekhm1 / 37520 FlyBaseID:FBgn0034694 Length:720 Species:Drosophila melanogaster
Sequence 2:XP_011521462.1 Gene:DEF8 / 54849 HGNCID:25969 Length:520 Species:Homo sapiens


Alignment Length:248 Identity:63/248 - (25%)
Similarity:110/248 - (44%) Gaps:66/248 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   357 PTEE------LTGSRFF-QRSVSVSSSVSLRSPTTDRCSYNALLRKHESNRESGAGWS--EIWEK 412
            |.|:      |...||: ::|.||..       |.|:|  |.::            |.  :.|..
Human   187 PNEDEPNIRVLLEHRFYKEKSKSVKQ-------TCDKC--NTII------------WGLIQTWYT 230

  Fly   413 -----FRASASNLNVAQPQRDTDPPISEDLSDLQSLDTNSEFELLTSEFDMVELQQMVAQLCQLA 472
                 :|..:..||:.     :.|.:|..:|.      .:|:||               .:|.  
Human   231 CTGCYYRCHSKCLNLI-----SKPCVSSKVSH------QAEYEL---------------NICP-- 267

  Fly   473 REPGLDAQGFLCKSCQHPLGI-GY-SNFQVCAFSGSYYCNSCMDVEMQLIPARIIYNWDFRKYSV 535
             |.|||:|.:.|..|:.|:.: |. |..:.|.::|.|||:.|...::.:||||:::||||....|
Human   268 -ETGLDSQDYRCAECRAPISLRGVPSEARQCDYTGQYYCSHCHWNDLAVIPARVVHNWDFEPRKV 331

  Fly   536 SKRAATFLAEFRSHPFLDMQLLNPRIYFASDAMAELQSLRIRLNFIRAYLYTC 588
            |:.:..:||...|.|.|.::.:||.::...:.:.|::.||..:..::.|..||
Human   332 SRCSMRYLALMVSRPVLRLREINPLLFSYVEELVEIRKLRQDILLMKPYFITC 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Plekhm1NP_611639.1 RUN 54..185 CDD:280855
zf-RING_9 500..700 CDD:290612 29/89 (33%)
DEF8XP_011521462.1 C1 200..253 CDD:294036 15/78 (19%)
zf-RING_9 295..>399 CDD:290612 29/90 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1829
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4753
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D177737at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.770

Return to query results.
Submit another query.