DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Plekhm1 and DEF8

DIOPT Version :9

Sequence 1:NP_611639.1 Gene:Plekhm1 / 37520 FlyBaseID:FBgn0034694 Length:720 Species:Drosophila melanogaster
Sequence 2:NP_648549.1 Gene:DEF8 / 39381 FlyBaseID:FBgn0046296 Length:492 Species:Drosophila melanogaster


Alignment Length:249 Identity:84/249 - (33%)
Similarity:133/249 - (53%) Gaps:8/249 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   460 ELQQMVAQLCQLAREPGLDAQGFLCKSCQHPLGI--GYSNFQVCAFSGSYYCNSCMDVEMQLIPA 522
            |.|..::::|.   |.||.:||:.|..|...|.|  .:...::|.:||.|||..|...:...|||
  Fly   221 ERQHPISEICP---EIGLASQGYKCAECGTMLNIKNTWIEPRLCDYSGLYYCPRCNWNDSNFIPA 282

  Fly   523 RIIYNWDFRKYSVSKRAATFLAEFRSHPFLDMQLLNPRIYFASDAMAELQSLRIRLNFIRAYLYT 587
            |||:||||....||:.|...:..|.:.|.:.::..||:::...:.:..::.||..|..:|.||..
  Fly   283 RIIHNWDFSPRRVSRTALQEIRLFLNKPLIRLEEDNPKLFVFVEKLCAVKKLRQNLVHMRHYLAA 347

  Fly   588 C-APSSIELLQNQFAGREYLYEHIHLYSIADLALIQRGVLCQQLQKAFKLGEAHVLKCRLCHLKG 651
            | ..|.::|:..|...|.:|.:....||::||:.::.|.|.:.||..||....|:..|.:|..:.
  Fly   348 CKIASELKLVDQQLGVRRHLAQSNEFYSLSDLSQVESGALSEFLQGVFKAFNDHIRSCPMCLAQA 412

  Fly   652 FICEICQSPRVLYPFHISTTFRCLACGAVFHAECLNEKQP-CPKCERIRKREDQ 704
            :|||||.:..|::||. ....:|..|.::||..||..|.. ||||.||::|..|
  Fly   413 YICEICSNNEVIFPFD-DGCIKCDQCNSIFHRVCLTRKNMICPKCIRIQERRLQ 465

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Plekhm1NP_611639.1 RUN 54..185 CDD:280855
zf-RING_9 500..700 CDD:290612 70/201 (35%)
DEF8NP_648549.1 C1 173..214 CDD:197519
zf-RING_9 259..461 CDD:290612 70/202 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445274
Domainoid 1 1.000 97 1.000 Domainoid score I2433
eggNOG 1 0.900 - - E1_KOG1829
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4753
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D177737at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3402
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12326
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.800

Return to query results.
Submit another query.